Diaphorina citri psyllid: psy17740

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----

MNSTPPRTPSPLLSTTSIPVSVIMKVNKDGTCIPDPFGIREMKPKQIKDISLKKMLNVQDMRKKCVQMNNEETSYNILKSLKYKMSDRKEMIFVESKDTNRDKETSEEAANHETKNACVNTKSTCVPLEASENEAFQANIQMDASTTCADMTSFVPALPRSQNLNIAQSISNGFPDMLPNPNPSSPSYGPGPQTVIFTGGSFIPVDKSSPLFIFDKKPVNSVKSNCPSFLFFAQPPRENKEIVTSNKIKKSNKPATNDPRRRIFECNYENCGKNYFKSSHLKAHMRTHTGERPFLCQWTGCGRRFSRSDELSRHKRTHTGEKKFGCSICNRRFMRSDHLAKHVKRHSKDGAITPSNIGTPSNVLRNANVAFNMMVTNLPHPVPA

ccccccccccccccccccccEEEEEEccccccccccccccccccccccccHHHHccccccHHHHHHHcccccccHHHHHccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc

****************************DGTCIPDPF***********DISLKKMLNVQDMRKKCVQ******SYNILKSLKY****************************************************************CA****F***************************************TVIFTGGSFIPVDKSSPLFIFDKKPVNSVKSNCPSFLFFA****************************RIFECNYENCGKNYFKSSHLKAHMRTHTGERPFLCQWTGCGRRFSRSDELSRHKRTHTGEKKFGCSICNRRFMRSDHLAKHV*******************VLRNANVAFNMMV*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0097067 [BP]	cellular response to thyroid hormone stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0097066, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0032870, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 242-383
View the alignment between query and template
View the model in PyMOL