Diaphorina citri psyllid: psy17744


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MYDESIDVVNAEEVQSPTGSVSSGENGEARVPMKIESSLRPGSAMKMQLSEHQTHIPLHSRTNSPRGDSSFDEDDYEDEDEDGDDGGEGGGADKAYDPLEFAHLATSTDLKEMFAYIEKYTPQPIDLTYKLRPFIPDYIPAVGDIDAFIKVARPDGRPDSLGLTVLDEPCFEQSDPAILNLQLRQSSKCPTSSKATIIKKVEDADKNKKAIDRWIKDIGDLHKNKPPPSVHYSRGMPDLDNLMQEWSNDVEQTISEVGLPPEDLDCDLTTYIDLMAAILDIPRFESRIETLHVIFSLYAAIQSSSNQNAAYPGSGNNGGGTPMRLN
cccccEEcccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHcccccccccHHHHHccccHHHcHHHHHHHHHHHHHHHcccccccEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
MYDESIDVVN**************************************************************************************DPLEFAHLATSTDLKEMFAYIEKYTPQPIDLTYKLRPFIPDYIPAVGDIDAFIKVARPDGRPDSLGLTVLDEPCFEQSDPAILNL***************************KAIDRWIKDIGDLH***P******SRGMPDLDNLMQEWSNDVEQTISEVGLPPEDLDCDLTTYIDLMAAILDIPRFESRIETLHVIFSLYAAIQSS**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDESIDVVNAEEVQSPTGSVSSGENGEARVPMKIESSLRPGSAMKMQLSEHQTHIPLHSRTNSPRGDSSFDEDDYEDEDEDGDDGGEGGGADKAYDPLEFAHLATSTDLKEMFAYIEKYTPQPIDLTYKLRPFIPDYIPAVGDIDAFIKVARPDGRPDSLGLTVLDEPCFEQSDPAILNLQLRQSSKCPTSSKATIIKKVEDADKNKKAIDRWIKDIGDLHKNKPPPSVHYSRGMPDLDNLMQEWSNDVEQTISEVGLPPEDLDCDLTTYIDLMAAILDIPRFESRIETLHVIFSLYAAIQSSSNQNAAYPGSGNNGGGTPMRLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Intraflagellar transport protein 46 homolog Forms part of a complex involved in intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia. May play a role in chondrocyte maturation and skeletogenesis.confidentQ1LZB4
Intraflagellar transport protein 46 homolog Forms part of a complex involved in intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia. May play a role in chondrocyte maturation and skeletogenesis.confidentQ6AXQ9
Intraflagellar transport protein 46 homolog Forms part of a complex involved in intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia. May play a role in chondrocyte maturation and skeletogenesis.confidentQ9DB07

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031512 [CC]motile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043064 [BP]flagellum organizationprobable
GO:0060170 [CC]cilium membraneprobableGO:0043229, GO:0071944, GO:0005929, GO:0043227, GO:0043226, GO:0044446, GO:0031090, GO:0031514, GO:0016020, GO:0044459, GO:0031253, GO:0005886, GO:0042995, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044425, GO:0044422
GO:0005932 [CC]microtubule basal bodyprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0005622, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0031647 [BP]regulation of protein stabilityprobableGO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0042073 [BP]intraflagellar transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0030030, GO:0006810, GO:0007018, GO:0016043, GO:0030705, GO:0006928, GO:0044765, GO:0010970, GO:0044763, GO:0071840, GO:0051649, GO:0008150, GO:0009987, GO:0044782, GO:0051179, GO:0044699, GO:0051641
GO:0060286 [BP]flagellar cell motilityprobable
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030092 [BP]regulation of flagellum assemblyprobable
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 134-150
View the alignment between query and template
View the model in PyMOL