Diaphorina citri psyllid: psy17775

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MSAPTKLNVYKNDSESWDYTQPTLGRTKDGPPSRPGPLLPEPPRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGRTD
cccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccCEEEEcccHHHHHHHHHHHcccEEccccEEEEEEcccccccccccccccccccccCECccccccccccccHHHcccccccccccEEEEcccccccHHHHHHHHcccc
**APTKLNVYKNDSESWDYT**********************************************YYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSH*************FT*****************IQPPSQLLHFFNAPPDITEEQLTDISGR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAPTKLNVYKNDSESWDYTQPTLGRTKDGPPSRPGPLLPEPPRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGRTD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033119 [BP]negative regulation of RNA splicingprobableGO:0051252, GO:0010605, GO:0045934, GO:0019222, GO:0008150, GO:0060255, GO:0031323, GO:0051253, GO:0043484, GO:0031324, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0009892, GO:0010468, GO:0048523, GO:0080090
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TYT, chain A
Confidence level:very confident
Coverage over the Query: 66-90,101-211
View the alignment between query and template
View the model in PyMOL