Psyllid ID: psy17775

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MSAPTKLNVYKNDSESWDYTQPTLGRTKDGPPSRPGPLLPEPPRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGRTD
cccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEEEEcccHHHHHHHHHHHcccEEccccEEEEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccccccEEEEcccccccHHHHHHHHcccc
cccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHEEEEEEEEccHEEEEEEEcccccccccEEEEcccHHHHHHHHHHHcccEEEcccEEEEEEcccccEEEcccccccccccccccccccccccccccccHHHcccccccccEEEEEcccccccHHHHHHHHHccc
msaptklnvykndseswdytqptlgrtkdgppsrpgpllpepprrlptpsgppsmpnyrggypdddyygappafefersynspvldkfigkprgmsgppsgpegccmvqmGDTLSAERAMGNLSKTLLCNGKRLAVAYSKqvflsdvshpyelpdgsesfkdftgsrknrfmnpkmamknriqppsqllhffnappditeeqltdisgrtd
msaptklnvykndseswdytqptlgrtkdgppsrpGPLLPEPPRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVShpyelpdgsesfkdftgsRKNRFMNPKMAMKNRIQPPSQLLHFFNAppditeeqltdisgrtd
MSAPTKLNVYKNDSESWDYTQPTLGRTKDgppsrpgpllpepprrlptpsgppsMPNYRggypdddyygappaFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGRTD
******************************************************************YYG***AFEF*******VL*******************CCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSH**************************************************************
*SAPTKLNVYKNDSESWDYT***********************************************YGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFL******************FT*****************IQPPSQLLHFFNAPPDITEEQLTDISGR**
********VYKNDSESWDYTQPTLG**********GPLLPEPPRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGRTD
**APTKLNVYKNDSESWDYTQPTLGR********PGPLLPEPPRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAPTKLNVYKNDSESWDYTQPTLGRTKDGPPSRPGPLLPEPPRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGRTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
Q921F4591 Heterogeneous nuclear rib yes N/A 0.928 0.331 0.367 9e-26
Q8WVV9542 Heterogeneous nuclear rib yes N/A 0.928 0.361 0.358 1e-25
P14866589 Heterogeneous nuclear rib no N/A 0.938 0.336 0.334 4e-22
Q8R081586 Heterogeneous nuclear rib no N/A 0.938 0.337 0.330 6e-22
Q8BHD7523 Polypyrimidine tract-bind no N/A 0.459 0.185 0.356 0.0001
Q6ICX4432 Polypyrimidine tract-bind yes N/A 0.407 0.199 0.366 0.0001
O95758552 Polypyrimidine tract-bind no N/A 0.459 0.175 0.356 0.0001
Q9Z118523 Polypyrimidine tract-bind no N/A 0.459 0.185 0.356 0.0001
Q29099557 Polypyrimidine tract-bind no N/A 0.445 0.168 0.357 0.0004
>sp|Q921F4|HNRLL_MOUSE Heterogeneous nuclear ribonucleoprotein L-like OS=Mus musculus GN=Hnrpll PE=1 SV=3 Back     alignment and function desciption
 Score =  116 bits (291), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 113/237 (47%), Gaps = 41/237 (17%)

Query: 4   PTKLNVYKNDSESWDYTQPTLGRTK------------DGPPS-------RPGPLLPEPPR 44
           PT+LNV +ND++SWDYT+P LGR              D P S         GPLLP P R
Sbjct: 293 PTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILGDHPSSFRHDGYGSHGPLLPLPSR 352

Query: 45  RLPTPSGPPSMPNY----------RGGYPDDDYYGAPPAFEFE----RSYNSPVLDKFIG 90
                   P +  Y           GG P           + +    R +N   L   I 
Sbjct: 353 YRMGSRDTPELVAYPLPQASSSYMHGGSPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIE 412

Query: 91  KPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDV-SH 149
           K + M   P    G  +V+MGD  + ERA+ +L+   L  GKRL V  SKQ   S V S 
Sbjct: 413 KVKFMKTIP----GTALVEMGDEYAVERAVTHLNNVKL-FGKRLNVCVSKQ--HSVVPSQ 465

Query: 150 PYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDI 206
            +EL DG+ S+KDF  S+ NRF +   A KN IQPPS +LH++N P  +TEE  T +
Sbjct: 466 IFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKL 522
RNA-binding protein that functions as regulator of alternative splicing for multiple target mRNAs, including PTPRC/CD45 and STAT5A. Required for alternative splicing of PTPRC.
Mus musculus (taxid: 10090)
>sp|Q8WVV9|HNRLL_HUMAN Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens GN=HNRPLL PE=1 SV=1 Back     alignment and function description
>sp|P14866|HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2 Back     alignment and function description
>sp|Q8R081|HNRPL_MOUSE Heterogeneous nuclear ribonucleoprotein L OS=Mus musculus GN=Hnrnpl PE=1 SV=2 Back     alignment and function description
>sp|Q8BHD7|PTBP3_MOUSE Polypyrimidine tract-binding protein 3 OS=Mus musculus GN=Ptbp3 PE=2 SV=1 Back     alignment and function description
>sp|Q6ICX4|PTBP3_ARATH Polypyrimidine tract-binding protein homolog 3 OS=Arabidopsis thaliana GN=At1g43190 PE=2 SV=1 Back     alignment and function description
>sp|O95758|PTBP3_HUMAN Polypyrimidine tract-binding protein 3 OS=Homo sapiens GN=PTBP3 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z118|PTBP3_RAT Polypyrimidine tract-binding protein 3 OS=Rattus norvegicus GN=Ptbp3 PE=2 SV=1 Back     alignment and function description
>sp|Q29099|PTBP1_PIG Polypyrimidine tract-binding protein 1 OS=Sus scrofa GN=PTBP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
383856703 421 PREDICTED: heterogeneous nuclear ribonuc 0.957 0.479 0.370 7e-36
328792476 394 PREDICTED: heterogeneous nuclear ribonuc 0.957 0.512 0.370 8e-36
340708741 479 PREDICTED: heterogeneous nuclear ribonuc 0.957 0.421 0.370 2e-35
350413134 479 PREDICTED: heterogeneous nuclear ribonuc 0.957 0.421 0.370 2e-35
328724092 428 PREDICTED: heterogeneous nuclear ribonuc 0.905 0.446 0.404 2e-32
307214686235 Heterogeneous nuclear ribonucleoprotein 0.492 0.442 0.586 2e-31
322792288 354 hypothetical protein SINV_02525 [Solenop 0.786 0.468 0.435 5e-31
380022117 337 PREDICTED: heterogeneous nuclear ribonuc 0.492 0.308 0.576 5e-31
307166549274 Heterogeneous nuclear ribonucleoprotein 0.492 0.379 0.576 8e-31
332023719 363 Heterogeneous nuclear ribonucleoprotein 0.492 0.286 0.576 1e-30
>gi|383856703|ref|XP_003703847.1| PREDICTED: heterogeneous nuclear ribonucleoprotein L-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 131/270 (48%), Gaps = 68/270 (25%)

Query: 1   MSAPTKLNVYKNDSESWDYTQPTLGRTKDGPPS----RPGPLLPEPPR-RLPTPSGPPSM 55
            + PTKLNVYKND+ESWDYT PTLG +     +    RP PLL EP     P P G    
Sbjct: 60  FAKPTKLNVYKNDAESWDYTTPTLGSSAHKNDATGNGRPAPLLAEPRYGAAPQPYGSTPQ 119

Query: 56  PNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGMSG------------------ 97
             +  G   D Y      F    +Y  P ++++ G     SG                  
Sbjct: 120 VTFPPGAGHDRY---EENFNGPATYAEPYVERY-GIKSDFSGREPLHPTPPRPNYVPTLG 175

Query: 98  --PPSGPEGCCM---------------------------------------VQMGDTLSA 116
             PPS  +G  M                                       +QMGD+++ 
Sbjct: 176 QTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMIQMGDSIAV 235

Query: 117 ERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKM 176
           ER + NL+   +    RL + +SKQ FLSDV++PY LPD + SFKDFTGS+ NRF+NP M
Sbjct: 236 ERCLQNLNNVTIGTDGRLQLGFSKQAFLSDVTNPYILPDKTASFKDFTGSKNNRFLNPAM 295

Query: 177 AMKNRIQPPSQLLHFFNAPPDITEEQLTDI 206
           A KNRIQPPS+++HFFN PPD+TEE +  +
Sbjct: 296 ANKNRIQPPSKIVHFFNTPPDLTEETVHRV 325

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328792476|ref|XP_003251730.1| PREDICTED: heterogeneous nuclear ribonucleoprotein L [Apis mellifera] Back     alignment and taxonomy information
>gi|340708741|ref|XP_003392980.1| PREDICTED: heterogeneous nuclear ribonucleoprotein L-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350413134|ref|XP_003489890.1| PREDICTED: heterogeneous nuclear ribonucleoprotein L-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328724092|ref|XP_001949062.2| PREDICTED: heterogeneous nuclear ribonucleoprotein L-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307214686|gb|EFN89615.1| Heterogeneous nuclear ribonucleoprotein L [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322792288|gb|EFZ16272.1| hypothetical protein SINV_02525 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|380022117|ref|XP_003694900.1| PREDICTED: heterogeneous nuclear ribonucleoprotein L-like, partial [Apis florea] Back     alignment and taxonomy information
>gi|307166549|gb|EFN60616.1| Heterogeneous nuclear ribonucleoprotein L [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332023719|gb|EGI63943.1| Heterogeneous nuclear ribonucleoprotein L [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
FB|FBgn0003435480 sm "smooth" [Drosophila melano 0.492 0.216 0.538 1.9e-32
ZFIN|ZDB-GENE-040426-2707522 hnrnpl2 "heterogeneous nuclear 0.469 0.189 0.495 2.1e-27
ZFIN|ZDB-GENE-040426-710536 hnrpl "heterogeneous nuclear r 0.478 0.188 0.475 9.6e-26
UNIPROTKB|E1BIB4588 HNRNPL "Uncharacterized protei 0.587 0.210 0.415 5e-25
UNIPROTKB|E2R944588 HNRNPL "Uncharacterized protei 0.587 0.210 0.415 5e-25
UNIPROTKB|P14866589 HNRNPL "Heterogeneous nuclear 0.587 0.210 0.415 5.1e-25
MGI|MGI:104816586 Hnrnpl "heterogeneous nuclear 0.587 0.211 0.407 8.1e-25
UNIPROTKB|F2Z3R2586 Hnrnpl "Protein Hnrnpl" [Rattu 0.587 0.211 0.407 8.1e-25
UNIPROTKB|F1LQ48595 Hnrnpl "Protein Hnrnpl" [Rattu 0.587 0.208 0.407 8.6e-25
UNIPROTKB|F1LPP9623 Hnrnpl "Protein Hnrnpl" [Rattu 0.587 0.199 0.407 1e-24
FB|FBgn0003435 sm "smooth" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 304 (112.1 bits), Expect = 1.9e-32, Sum P(2) = 1.9e-32
 Identities = 56/104 (53%), Positives = 78/104 (75%)

Query:   103 EGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKD 162
             EG  MVQMGD ++ ER + +L+   +  G ++ +A+SKQ FLS+V +P+ LPD S SFK+
Sbjct:   283 EGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKE 342

Query:   163 FTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDI 206
             +TGS+ NRF++P  A KNRIQPPS++LHFFN PP +TE+QL  I
Sbjct:   343 YTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGI 386
GO:0030529 "ribonucleoprotein complex" evidence=NAS
GO:0003729 "mRNA binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0007411 "axon guidance" evidence=IMP
GO:0008343 "adult feeding behavior" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
ZFIN|ZDB-GENE-040426-2707 hnrnpl2 "heterogeneous nuclear ribonucleoprotein L2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-710 hnrpl "heterogeneous nuclear ribonucleoprotein L" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BIB4 HNRNPL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R944 HNRNPL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P14866 HNRNPL "Heterogeneous nuclear ribonucleoprotein L" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:104816 Hnrnpl "heterogeneous nuclear ribonucleoprotein L" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z3R2 Hnrnpl "Protein Hnrnpl" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ48 Hnrnpl "Protein Hnrnpl" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPP9 Hnrnpl "Protein Hnrnpl" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 5e-30
cd1242784 cd12427, RRM4_hnRNPL_like, RNA recognition motif 4 1e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 7e-06
cd1242471 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 2e-04
cd12785100 cd12785, RRM2_hnRNPL, RNA recognition motif 2 in v 3e-04
cd1278696 cd12786, RRM2_hnRPLL, RNA recognition motif 2 in v 0.002
cd1270484 cd12704, RRM4_hnRNPL, RNA recognition motif 4 in v 0.002
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information 
 Score =  114 bits (288), Expect = 5e-30
 Identities = 75/251 (29%), Positives = 101/251 (40%), Gaps = 53/251 (21%)

Query: 2   SAPTKLNVYKNDSESWDYTQP--------TLGRTK-----------------DGPPSRPG 36
           + PT+LNV  ND +S DYT P         L +T                  DG  S  G
Sbjct: 171 AKPTRLNVKYNDDDSRDYTNPDLPGRRDPGLDQTHRQRQPALLGQHPSSYGHDGYSSHGG 230

Query: 37  PLLPEP-PRRLPTPSGPPSMPNYRGGYPDDDYYGAPPAFEFERSYNSPVLDKFIGKPRGM 95
           PL P     R+  P GPPS   YR  Y       A  ++         VL    G  +  
Sbjct: 231 PLAPLAGGDRMGPPHGPPSR--YRPAYEAAPLAPAISSYGPAGGGPGSVL-MVSGLHQEK 287

Query: 96  SGPPS------------------GPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVA 137
                                    +   +++M D   A+ A+ +L+   L  GK L V 
Sbjct: 288 VNCDRLFNLFCVYGNVERVKFMKNKKETALIEMADPYQAQLALTHLNGVKL-FGKPLRVC 346

Query: 138 YSKQVFLSDVSHP--YELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAP 195
            SKQ    +V  P   +L DG  S+KD++ SR +RF  P  A KN IQPPS  LH  N P
Sbjct: 347 PSKQ---QNVQPPREGQLDDGLTSYKDYSSSRNHRFKKPGSANKNNIQPPSATLHLSNIP 403

Query: 196 PDITEEQLTDI 206
             ++EE L ++
Sbjct: 404 LSVSEEDLKEL 414

Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067). Length = 481
>gnl|CDD|240873 cd12427, RRM4_hnRNPL_like, RNA recognition motif 4 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|241229 cd12785, RRM2_hnRNPL, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein L (hnRNP-L) Back     alignment and domain information
>gnl|CDD|241230 cd12786, RRM2_hnRPLL, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein L-like (hnRNP-LL) Back     alignment and domain information
>gnl|CDD|241148 cd12704, RRM4_hnRNPL, RNA recognition motif 4 in vertebrate heterogeneous nuclear ribonucleoprotein L (hnRNP-L) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
KOG1456|consensus494 100.0
KOG1190|consensus492 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
KOG4206|consensus221 99.59
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.59
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.49
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.42
KOG0145|consensus 360 99.28
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.23
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.21
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.18
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.1
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.06
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.02
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.99
KOG0117|consensus 506 98.94
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.89
KOG0109|consensus 346 98.86
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.7
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.7
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.66
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.56
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.53
KOG0131|consensus203 98.49
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.4
KOG1190|consensus 492 98.39
smart0036071 RRM RNA recognition motif. 98.35
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 98.32
KOG0127|consensus 678 98.29
smart0036272 RRM_2 RNA recognition motif. 98.28
KOG0107|consensus195 98.25
KOG0148|consensus 321 98.24
KOG0110|consensus725 98.16
KOG0123|consensus 369 98.15
KOG1456|consensus 494 98.14
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.11
KOG0117|consensus 506 98.08
KOG0114|consensus124 98.06
KOG0123|consensus 369 98.05
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.03
KOG0144|consensus 510 98.02
smart0036170 RRM_1 RNA recognition motif. 97.97
PLN03120 260 nucleic acid binding protein; Provisional 97.95
KOG1457|consensus284 97.86
KOG0145|consensus360 97.77
KOG0122|consensus270 97.73
PLN03121243 nucleic acid binding protein; Provisional 97.61
KOG0108|consensus 435 97.55
KOG4207|consensus256 97.49
KOG0111|consensus 298 97.41
KOG0125|consensus 376 97.35
PLN03213 759 repressor of silencing 3; Provisional 97.24
KOG4208|consensus214 97.23
KOG0127|consensus 678 97.13
KOG0130|consensus170 96.99
KOG0132|consensus 894 96.93
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.8
KOG1548|consensus382 96.8
KOG0126|consensus219 96.76
KOG0124|consensus 544 96.64
KOG0148|consensus321 96.46
KOG4205|consensus 311 96.27
KOG0105|consensus 241 96.25
KOG0109|consensus 346 96.23
KOG0113|consensus335 96.12
KOG0147|consensus 549 95.99
KOG0131|consensus203 95.91
KOG4454|consensus 267 95.83
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 95.75
KOG0146|consensus 371 95.68
KOG0144|consensus 510 95.6
KOG0147|consensus 549 95.55
KOG0121|consensus153 95.34
smart0036272 RRM_2 RNA recognition motif. 94.93
KOG0146|consensus371 94.83
KOG0106|consensus216 94.61
KOG0114|consensus124 94.48
KOG4206|consensus221 94.16
KOG4212|consensus 608 93.94
KOG4211|consensus 510 93.88
KOG1995|consensus 351 93.77
KOG0151|consensus 877 93.68
COG0724 306 RNA-binding proteins (RRM domain) [General functio 93.54
KOG4212|consensus608 93.48
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.23
KOG0120|consensus500 93.2
KOG4660|consensus 549 92.91
KOG0153|consensus377 92.62
KOG0415|consensus479 92.3
KOG0149|consensus247 91.97
KOG0533|consensus243 91.69
KOG4209|consensus231 90.79
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 90.74
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 89.56
KOG2193|consensus 584 88.74
KOG4307|consensus944 88.56
KOG1457|consensus284 88.53
KOG4660|consensus 549 88.22
KOG4661|consensus 940 88.0
KOG0110|consensus725 87.64
KOG0125|consensus 376 86.12
KOG1365|consensus 508 84.92
KOG0533|consensus 243 83.42
KOG0122|consensus270 83.29
KOG0130|consensus170 80.22
>KOG1456|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.8e-56  Score=403.79  Aligned_cols=199  Identities=44%  Similarity=0.681  Sum_probs=176.6

Q ss_pred             CCCCceeeeecCCCccccccCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC-----CCCC----------CCC----CC
Q psy17775          1 MSAPTKLNVYKNDSESWDYTQPTLGRT-KDGPPSRPGPLLPEPPRRLPTPSG-----PPSM----------PNY----RG   60 (211)
Q Consensus         1 ~s~~~~LnV~~N~~~s~DyTnp~L~~~-~~~~~~~~~~~~~~~~g~~p~~~g-----~~~~----------~~~----~~   60 (211)
                      ||||++|||.+||.+|||||.|+|+.. ++++...+++.+|+++|.+|..+|     |.+.          +++    +.
T Consensus       195 yAkP~rlnV~knd~DtwDyTlp~~~~~~~~g~~~~~r~~~p~~~~~~pss~~G~h~~y~sg~~~~p~~~~P~r~~~~~~~  274 (494)
T KOG1456|consen  195 YAKPTRLNVQKNDKDTWDYTLPDLRGPYDPGRNHYDRQRQPAPLGYHPSSRGGGHSGYYSGDRHGPPHPPPSRYRDGYRD  274 (494)
T ss_pred             ecCcceeeeeecCCccccccCCCCCCCCCCCCCCCccccCCCccCCChhhcCCCCCCCcccccCCCCCCCCCCCcccccc
Confidence            799999999999999999999999655 444666678899999999998874     2210          011    11


Q ss_pred             --C-------C--CCCccCCCC-CCCccccccc------cceEeeEecCCCCCCCCCCCCCCeEEEEeCCHHHHHHHHHH
Q psy17775         61 --G-------Y--PDDDYYGAP-PAFEFERSYN------SPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGN  122 (211)
Q Consensus        61 --~-------~--p~~~v~nl~-~~i~~d~LFn------nV~rvK~l~~~~~~~~~~~~k~g~AlVqm~D~~~A~~Ai~~  122 (211)
                        |       .  ++.|||||. .|||||+|||      ||+||||||          .|+|+|||||+|++++++|++|
T Consensus       275 ~~g~a~p~g~~~g~VmMVyGLdh~k~N~drlFNl~ClYGNV~rvkFmk----------Tk~gtamVemgd~~aver~v~h  344 (494)
T KOG1456|consen  275 GRGYASPGGGAPGCVMMVYGLDHGKMNCDRLFNLFCLYGNVERVKFMK----------TKPGTAMVEMGDAYAVERAVTH  344 (494)
T ss_pred             CCCCCCCCCCCCCcEEEEEeccccccchhhhhhhhhhcCceeeEEEee----------cccceeEEEcCcHHHHHHHHHH
Confidence              1       1  112699997 5999999999      999999999          9999999999999999999999


Q ss_pred             hCCceecCCceeEEeecCCcccccCCCCccCCCCCCcccccccCcccccCCchhccCCCCCCCcceEEeecCCCCCCHHH
Q psy17775        123 LSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQ  202 (211)
Q Consensus       123 L~g~~Lf~Gk~L~V~~SK~~~i~~~~~~~~l~dgs~~~kdfs~s~~nRf~~~~~~~kn~i~pPs~~Lh~~NlP~~~tee~  202 (211)
                      ||+..|| |++|+|++|||.++.++ +|+.|+|||++||||+.||+|||.++++|+||||+|||++|||||+|..+|||+
T Consensus       345 Lnn~~lf-G~kl~v~~SkQ~~v~~~-~pflLpDgSpSfKdys~SkNnRFssp~qAsKNrIq~Ps~vLHffNaP~~vtEe~  422 (494)
T KOG1456|consen  345 LNNIPLF-GGKLNVCVSKQNFVSPV-QPFLLPDGSPSFKDYSGSKNNRFSSPEQASKNRIQPPSNVLHFFNAPLGVTEEQ  422 (494)
T ss_pred             hccCccc-cceEEEeeccccccccC-CceecCCCCcchhhcccccccccCChhHhhcccccCCcceeEEecCCCccCHHH
Confidence            9999999 99999999999999985 999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhccCC
Q psy17775        203 LTDISGRTD  211 (211)
Q Consensus       203 L~~lf~~~G  211 (211)
                      |.+||.+++
T Consensus       423 l~~i~nek~  431 (494)
T KOG1456|consen  423 LIGICNEKD  431 (494)
T ss_pred             HHHHhhhcC
Confidence            999998764

>KOG1190|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
3to8_A218 Crystal Structure Of The Two C-Terminal Rrm Domains 3e-19
3tyt_A205 Crystal Structure Of A Heterogeneous Nuclear Ribonu 7e-19
3s01_A212 Crystal Structure Of A Heterogeneous Nuclear Ribonu 2e-16
2adc_A229 Solution Structure Of Polypyrimidine Tract Binding 1e-05
1qm9_A198 Nmr, Representative Structure Length = 198 2e-05
2e5i_A124 Solution Structure Of Rna Binding Domain 2 In Heter 2e-04
>pdb|3TO8|A Chain A, Crystal Structure Of The Two C-Terminal Rrm Domains Of Heterogeneous Nuclear Ribonucleoprotein L (Hnrnp L) Length = 218 Back     alignment and structure 
Iteration: 1

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 75/130 (57%), Gaps = 6/130 (4%)
Query: 77  ERSYNSPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAV 136
           +R +N   L   + K + M   P    G  MV+M D  + +RA+ +L+   +  G++L V
Sbjct: 26  DRVFNVFCLYGNVEKVKFMKSKP----GAAMVEMADGYAVDRAITHLNNNFMF-GQKLNV 80
Query: 137 AYSKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPP 196
             SKQ  +      Y L DGS S+KDF+ SR NRF  P+ A KNRIQ PS +LHFFNAP 
Sbjct: 81  CVSKQPAIMP-GQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPL 139
Query: 197 DITEEQLTDI 206
           ++TEE   +I
Sbjct: 140 EVTEENFFEI 149
>pdb|3TYT|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein L (Hnrpl) From Mus Musculus At 1.60 A Resolution Length = 205 Back     alignment and structure
>pdb|3S01|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein L (Hnrpl) From Mus Musculus At 2.15 A Resolution Length = 212 Back     alignment and structure
>pdb|2ADC|A Chain A, Solution Structure Of Polypyrimidine Tract Binding Protein Rbd34 Complexed With Cucucu Rna Length = 229 Back     alignment and structure
>pdb|1QM9|A Chain A, Nmr, Representative Structure Length = 198 Back     alignment and structure
>pdb|2E5I|A Chain A, Solution Structure Of Rna Binding Domain 2 In Heterogeneous Nuclear Ribonucleoprotein L-Like Length = 124 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-21
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-18
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-18
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 4e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 7e-05
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
 Score = 86.1 bits (213), Expect = 3e-21
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 104 GCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDF 163
              +VQM D   A+ AM +L+   L +GK + +  SK     +V  P E  +     KD+
Sbjct: 42  ENALVQMADGNQAQLAMSHLNGHKL-HGKPIRITLSKH---QNVQLPREGQEDQGLTKDY 97

Query: 164 TGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDI 206
             S  +RF  P       I PPS  LH  N PP ++EE L  +
Sbjct: 98  GNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVL 140
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.94
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.81
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.8
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.56
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.55
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.55
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.54
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.5
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.48
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.45
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.41
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.39
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.38
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.36
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.36
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.36
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.36
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.36
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.34
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.29
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.27
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.25
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.22
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.18
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.17
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.08
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.08
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.03
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.02
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.0
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.0
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.0
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.0
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.99
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.99
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.98
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.97
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.97
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.97
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.97
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.97
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.97
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.97
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.96
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.96
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.96
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.95
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.95
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.95
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.94
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.94
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.93
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.93
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.93
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.93
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.93
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.92
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.92
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.92
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.92
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.91
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.91
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.91
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.91
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.91
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.91
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.91
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.9
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.9
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.9
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.89
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.89
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.89
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.89
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.88
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.88
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.88
2div_A99 TRNA selenocysteine associated protein; structural 98.88
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.88
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.88
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.87
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.87
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.87
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.87
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.87
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.86
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.86
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.86
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.86
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.86
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.86
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.86
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.85
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.85
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.85
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.85
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.83
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.83
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.82
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.82
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.82
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.82
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.82
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.81
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.81
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.81
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.81
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.81
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.8
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.8
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.8
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.8
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.79
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.79
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.79
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.79
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.79
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.78
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.78
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.78
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.77
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.77
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.76
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.76
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.76
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.75
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.74
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.74
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.74
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.73
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.73
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.72
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.72
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.72
2dis_A109 Unnamed protein product; structural genomics, RRM 98.72
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.71
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.71
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.68
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.68
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.67
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.67
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.67
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.65
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.65
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.64
1x5p_A97 Negative elongation factor E; structure genomics, 98.63
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.62
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.62
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.62
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.62
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.61
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.61
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.6
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.6
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.59
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.59
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.59
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.58
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.58
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.58
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.57
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.99
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.56
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.55
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.55
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.53
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.53
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.53
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.53
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.52
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.51
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.5
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.49
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.49
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.48
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.48
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.47
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.47
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.43
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.42
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.42
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.39
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.39
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.37
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.36
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.35
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.35
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.33
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.33
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.33
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.31
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.27
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.26
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.26
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.24
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.22
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.02
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.02
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.01
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 97.97
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.94
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 97.88
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 97.87
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 97.86
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 97.8
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 97.75
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.69
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 97.69
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.64
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.6
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.49
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.48
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.43
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 97.38
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.38
1x4e_A85 RNA binding motif, single-stranded interacting pro 97.33
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 97.32
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 97.32
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.31
2cpj_A99 Non-POU domain-containing octamer-binding protein; 97.3
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 97.25
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 97.22
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 97.21
2la6_A99 RNA-binding protein FUS; structural genomics, nort 97.2
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 97.19
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.18
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 97.18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 97.17
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 97.17
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 97.16
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 97.15
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 97.15
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 97.14
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 97.13
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 97.13
2div_A99 TRNA selenocysteine associated protein; structural 97.11
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 97.11
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 97.1
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 97.1
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.09
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 97.09
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 97.09
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 97.09
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 97.08
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 97.08
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 97.08
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 97.06
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 97.06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 97.06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 97.05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 97.04
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 97.02
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 97.02
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 97.02
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 97.01
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 97.0
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 96.99
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 96.99
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 96.98
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 96.97
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 96.97
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.97
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 96.97
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 96.96
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 96.96
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 96.96
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 96.96
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 96.95
2cqd_A116 RNA-binding region containing protein 1; RNA recog 96.94
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 96.92
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 96.91
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 96.9
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 96.89
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 96.86
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 96.85
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 96.84
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 96.84
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 96.84
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 96.83
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 96.83
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 96.82
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 96.79
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 96.78
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 96.78
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 96.75
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 96.73
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 96.73
1x5o_A114 RNA binding motif, single-stranded interacting pro 96.71
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.71
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 96.7
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 96.7
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 96.68
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 96.68
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 96.65
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 96.65
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 96.61
2kt5_A124 RNA and export factor-binding protein 2; chaperone 96.61
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 96.6
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 96.6
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 96.58
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 96.53
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 96.52
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 96.51
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 96.5
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 96.49
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 96.48
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 96.46
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 96.45
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 96.37
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 96.33
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 96.32
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 96.26
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 96.24
2f3j_A177 RNA and export factor binding protein 2; RRM domai 96.22
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 96.17
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 96.12
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 96.09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 96.07
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 96.04
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 96.0
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 95.99
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 95.98
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 95.92
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 95.89
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 95.81
3n9u_C156 Cleavage and polyadenylation specificity factor S; 95.81
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 95.77
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 95.75
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 95.67
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 95.43
1x5p_A97 Negative elongation factor E; structure genomics, 95.24
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 95.16
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 95.11
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 95.07
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 94.95
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 94.92
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 94.39
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 94.05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 93.17
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 92.48
2dit_A112 HIV TAT specific factor 1 variant; structural geno 90.72
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 88.26
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 88.16
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 80.19
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
Probab=99.94  E-value=2.2e-26  Score=192.60  Aligned_cols=134  Identities=39%  Similarity=0.642  Sum_probs=122.7

Q ss_pred             ccCCCC-CCCccccc---cc---cceEeeEecCCCCCCCCCCCCCCeEEEEeCCHHHHHHHHHHhCCceecCCceeEEee
Q psy17775         66 DYYGAP-PAFEFERS---YN---SPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAY  138 (211)
Q Consensus        66 ~v~nl~-~~i~~d~L---Fn---nV~rvK~l~~~~~~~~~~~~k~g~AlVqm~D~~~A~~Ai~~L~g~~Lf~Gk~L~V~~  138 (211)
                      .|.||+ ..+++|.|   |.   +|++||+++          .++|+|||+|.|..+|+.||+.|||..|+ |++|+|.+
T Consensus         8 ~V~nL~~~~~~~~~L~~~F~~~G~v~~v~i~~----------~~~g~afV~f~~~~~A~~Ai~~lng~~~~-g~~l~v~~   76 (205)
T 3tyt_A            8 MVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMK----------SKPGAAMVEMADGYAVDRAITHLNNNFMF-GQKMNVCV   76 (205)
T ss_dssp             EEECCCTTTCCHHHHHHHHTTTSCEEEEEECT----------TSTTCEEEEESSHHHHHHHHHHHTTCEET-TEECEEEE
T ss_pred             EEeCCCcccCCHHHHHHHHHhcCCeEEEEEec----------CCCCEEEEEECCHHHHHHHHHHhCCCEEC-CceEEEEE
Confidence            489999 79999986   44   999999999          77899999999999999999999999999 99999999


Q ss_pred             cCCcccccCCCCccCCCCCCcccccccCcccccCCchhccCCCCCCCcceEEeecCCCCCCHHHHHhhhccCC
Q psy17775        139 SKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPKMAMKNRIQPPSQLLHFFNAPPDITEEQLTDISGRTD  211 (211)
Q Consensus       139 SK~~~i~~~~~~~~l~dgs~~~kdfs~s~~nRf~~~~~~~kn~i~pPs~~Lh~~NlP~~~tee~L~~lf~~~G  211 (211)
                      ||+..+.+ ..+..++++++.++||++++.+||..+..+.++++.+|+++|||.|||.++||++|+++|+++|
T Consensus        77 s~~~~~~p-~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~p~~~l~v~NLp~~~t~~~L~~~F~~~G  148 (205)
T 3tyt_A           77 SKQPAIMP-GQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELG  148 (205)
T ss_dssp             CSCSCCCC-CSCCBCTTSCBSEEECTTCTTCSCSSHHHHTTSCCCCCCSEEEEEEECTTCCHHHHHHHHHHHT
T ss_pred             ccCCccCC-CcccccccCCccccccCCCccccccCcccccccccCCCcceEEEeCCCCCCCHHHHHHHHHhcC
Confidence            99988753 3446788888889999999999999988778889999999999999999999999999999987
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-07
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Polypyrimidine tract-binding protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 46.7 bits (110), Expect = 1e-07
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 105 CCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAYSKQVFLSDVSHPYELPDGSESFKDFT 164
             +VQM D   A+ AM +L+   L +GK + +  SK     +V  P E  +     KD+ 
Sbjct: 42  NALVQMADGNQAQLAMSHLNGHKL-HGKPIRITLSKH---QNVQLPREGQEDQGLTKDYG 97

Query: 165 GSRKNRFMNP 174
            S  +RF  P
Sbjct: 98  NSPLHRFKKP 107

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.74
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.26
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.26
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.16
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.15
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.14
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.14
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.13
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.1
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.1
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.09
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.09
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.08
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.08
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.07
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.06
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.06
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.04
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.02
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.02
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.02
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.01
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.0
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.0
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.99
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.99
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.97
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.97
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.96
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.96
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.96
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.95
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.95
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.95
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.94
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.94
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.94
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.94
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.94
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.93
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.92
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.92
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.92
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.9
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.89
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.88
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.88
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.84
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.83
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.78
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.77
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.77
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.75
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.74
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.74
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.73
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.73
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.72
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.72
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.7
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.69
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.68
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.65
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.65
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.65
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.64
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.63
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.63
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.61
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.59
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.54
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.54
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.45
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.45
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.44
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.44
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.32
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.19
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.16
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.16
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.12
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.09
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.07
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.03
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.01
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 97.95
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.85
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 97.8
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 97.64
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.51
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.49
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 97.45
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 97.45
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 97.43
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 97.42
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.33
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.31
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.25
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 97.24
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.18
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.18
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.17
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 97.17
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 97.15
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 97.15
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 97.14
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.14
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.11
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.08
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.01
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 97.0
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 96.99
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.98
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.95
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 96.93
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 96.92
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 96.92
d2cpja186 Non-POU domain-containing octamer-binding protein, 96.87
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 96.86
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 96.83
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 96.8
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 96.8
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.74
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 96.69
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 96.65
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 96.6
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.55
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 96.49
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 96.48
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.44
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 96.35
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 96.24
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.2
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 95.92
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 95.91
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 95.65
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.42
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 95.35
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Polypyrimidine tract-binding protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.74  E-value=1.9e-18  Score=128.30  Aligned_cols=96  Identities=24%  Similarity=0.248  Sum_probs=85.4

Q ss_pred             ccCCCCC-CCccccc---cc---cceEeeEecCCCCCCCCCCCCCCeEEEEeCCHHHHHHHHHHhCCceecCCceeEEee
Q psy17775         66 DYYGAPP-AFEFERS---YN---SPVLDKFIGKPRGMSGPPSGPEGCCMVQMGDTLSAERAMGNLSKTLLCNGKRLAVAY  138 (211)
Q Consensus        66 ~v~nl~~-~i~~d~L---Fn---nV~rvK~l~~~~~~~~~~~~k~g~AlVqm~D~~~A~~Ai~~L~g~~Lf~Gk~L~V~~  138 (211)
                      .|.||++ .|+.+.|   |+   .|++|++++          .++|+|||+|.+.++|++||+.|+|..|+ |++|+|.|
T Consensus         6 ~V~nL~p~~~te~~L~~~F~~fG~I~~v~i~~----------~~kg~afV~f~~~~~A~~ai~~lng~~l~-g~~l~v~~   74 (109)
T d2adca1           6 LVSNLNPERVTPQSLFILFGVYGDVQRVKILF----------NKKENALVQMADGNQAQLAMSHLNGHKLH-GKPIRITL   74 (109)
T ss_dssp             EEESCCTTTCCHHHHHHHHHHHTCEEEEEECC----------TTSCCEEEEESCHHHHHHHHHHHTTCBCS-SSBCEEEC
T ss_pred             EEeCCCcccCCHHHHHHHHhhccccceEEEEe----------cccceEEEEECCHHHHHHHHHHhCCCEEC-CEEEEEEE
Confidence            4899964 6999986   44   999999999          78999999999999999999999999999 99999999


Q ss_pred             cCCcccccCCCCccCCCCCCcccccccCcccccCCch
Q psy17775        139 SKQVFLSDVSHPYELPDGSESFKDFTGSRKNRFMNPK  175 (211)
Q Consensus       139 SK~~~i~~~~~~~~l~dgs~~~kdfs~s~~nRf~~~~  175 (211)
                      ||+..+.   .+.+..+.....+||+++++|||..|.
T Consensus        75 s~~~~~~---~~~~~~~~~~~~~~~~~s~~~rf~~p~  108 (109)
T d2adca1          75 SKHQNVQ---LPREGQEDQGLTKDYGNSPLHRFKKPG  108 (109)
T ss_dssp             CSCCCCC---CCCSSSSTTTTEEECTTCSSCCCCSTT
T ss_pred             CCCCCCC---CCCccccCCCcccccCCCCCCCCCCCC
Confidence            9988775   356667777889999999999998864
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure