Diaphorina citri psyllid: psy17798


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFLT
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHHHcccEEEEEccccccCEcc
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine desulfurase, mitochondrial Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters. May be involved in the biosynthesis of molybdenum cofactor.confidentQ9Y697
Cysteine desulfurase, mitochondrial Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters. May be involved in the biosynthesis of molybdenum cofactor.confidentQ9Z1J3
Cysteine desulfurase, mitochondrial Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters. May be involved in the biosynthesis of molybdenum cofactor.confidentQ99P39

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingconfidentGO:0003674
GO:0044446 [CC]intracellular organelle partconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0018283 [BP]iron incorporation into metallo-sulfur clusterprobableGO:0044267, GO:0022607, GO:0044260, GO:0018282, GO:0019538, GO:0044237, GO:0043412, GO:0031163, GO:0006464, GO:0016226, GO:0071704, GO:0009058, GO:0036211, GO:0008150, GO:0016043, GO:0008152, GO:0009987, GO:0043170, GO:0044238, GO:0071840, GO:0044085
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0030170 [MF]pyridoxal phosphate bindingprobableGO:0043168, GO:0003674, GO:0048037, GO:0005488, GO:0043167
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006777 [BP]Mo-molybdopterin cofactor biosynthetic processprobableGO:0006732, GO:0044249, GO:0006807, GO:0009108, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0044260, GO:0043545, GO:0051189, GO:0051188, GO:0071704, GO:0018130, GO:0019720, GO:0044267, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0090407, GO:0046483, GO:0044238, GO:1901564, GO:1901566, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0032324, GO:0006793, GO:0019637
GO:0031119 [BP]tRNA pseudouridine synthesisprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0001522, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0008033, GO:0009987, GO:0006725, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0006396
GO:0006767 [BP]water-soluble vitamin metabolic processprobableGO:0044710, GO:0006766, GO:0008150, GO:0044281, GO:0008152
GO:0070903 [BP]mitochondrial tRNA thio-modificationprobableGO:0008152, GO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0044281, GO:0034660, GO:0034470, GO:0046085, GO:0007005, GO:0006139, GO:0044710, GO:0044260, GO:1901657, GO:0071840, GO:0042278, GO:0000963, GO:0016043, GO:0071704, GO:0010467, GO:1900864, GO:0006400, GO:0006996, GO:0008033, GO:0009987, GO:0006725, GO:0072521, GO:0070900, GO:0043412, GO:0044763, GO:0009116, GO:0034227, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0016070, GO:0044238, GO:0044699, GO:1901564, GO:1901135, GO:0044237, GO:0043170, GO:0006399, GO:0008150, GO:0000959, GO:0006396, GO:0070525
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0097163 [MF]sulfur carrier activityprobableGO:0005215, GO:0022892, GO:0003674
GO:0031071 [MF]cysteine desulfurase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0016783, GO:0003674
GO:0009000 [MF]selenocysteine lyase activityprobableGO:0003824, GO:0016829, GO:0016846, GO:0003674
GO:0002098 [BP]tRNA wobble uridine modificationprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0008033, GO:0009987, GO:0006725, GO:0002097, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0006396
GO:0006534 [BP]cysteine metabolic processprobableGO:0044238, GO:0044710, GO:0006520, GO:1901564, GO:0006082, GO:0009987, GO:0000096, GO:0044237, GO:0071704, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0009069, GO:1901605, GO:0044281
GO:0006879 [BP]cellular iron ion homeostasisprobableGO:0019725, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055072, GO:0044763, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0065007, GO:0055082, GO:0065008, GO:0044699
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T3I, chain A
Confidence level:very confident
Coverage over the Query: 4-109
View the alignment between query and template
View the model in PyMOL