Psyllid ID: psy17798


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFLT
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHHccccccEEEccccHHHHHHHHHHHHHcccEEEEEccccccEEcc
cccHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccEcc
mlpyltnaygnphsrthaygweseKAVEDARQEIATLincdpkeiiftsgatesnniAVKGVARFYKEKKKHvittqtehkcvldscrilegegfnvlgsnpgqggnflt
mlpyltnaygnphsrthayGWESEKAVEDARQEIATLINCDPKEIIftsgatesnniAVKGVARFYKEKKKhvittqtehkcvLDSCRILEgegfnvlgsnpgqggnflt
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFLT
*****************AYGWES*KAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVL************
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFL*
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFLT
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGGNFLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
Q9VKD3 462 Probable cysteine desulfu yes N/A 0.881 0.209 0.845 7e-45
Q99P39 451 Cysteine desulfurase, mit yes N/A 0.881 0.215 0.793 1e-44
Q9Y697 457 Cysteine desulfurase, mit yes N/A 0.881 0.212 0.804 2e-44
Q5RDE7 457 Cysteine desulfurase, mit yes N/A 0.881 0.212 0.804 2e-44
Q9Z1J3 451 Cysteine desulfurase, mit yes N/A 0.881 0.215 0.793 2e-44
O74351 501 Probable cysteine desulfu yes N/A 0.881 0.193 0.752 6e-41
Q54X04 450 Probable cysteine desulfu yes N/A 0.963 0.235 0.679 4e-37
P87185 488 Cysteine desulfurase, mit N/A N/A 0.881 0.198 0.711 8e-37
P87187 484 Cysteine desulfurase, mit N/A N/A 0.881 0.200 0.701 1e-36
A8GNU0 410 Cysteine desulfurase OS=R yes N/A 0.881 0.236 0.670 2e-36
>sp|Q9VKD3|NFS1_DROME Probable cysteine desulfurase, mitochondrial OS=Drosophila melanogaster GN=CG12264 PE=2 SV=1 Back     alignment and function desciption
 Score =  178 bits (452), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 82/97 (84%), Positives = 87/97 (89%)

Query: 1   MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVK 60
           MLPYLTN YGNPHSRTHAYGWE+E AVE AR+++ATLI  DPKEIIFTSGATESNNIAVK
Sbjct: 82  MLPYLTNFYGNPHSRTHAYGWETESAVEKAREQVATLIGADPKEIIFTSGATESNNIAVK 141

Query: 61  GVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNV 97
           GVARFY  KK+HVITTQTEHKCVLDSCR LE EGF V
Sbjct: 142 GVARFYGTKKRHVITTQTEHKCVLDSCRALENEGFKV 178




Catalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 7
>sp|Q99P39|NFS1_RAT Cysteine desulfurase, mitochondrial OS=Rattus norvegicus GN=Nfs1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y697|NFS1_HUMAN Cysteine desulfurase, mitochondrial OS=Homo sapiens GN=NFS1 PE=1 SV=3 Back     alignment and function description
>sp|Q5RDE7|NFS1_PONAB Cysteine desulfurase, mitochondrial OS=Pongo abelii GN=NFS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1J3|NFS1_MOUSE Cysteine desulfurase, mitochondrial OS=Mus musculus GN=Nfs1 PE=2 SV=2 Back     alignment and function description
>sp|O74351|NFS1_SCHPO Probable cysteine desulfurase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21D10.11c PE=3 SV=2 Back     alignment and function description
>sp|Q54X04|NFS1_DICDI Probable cysteine desulfurase, mitochondrial OS=Dictyostelium discoideum GN=nfs1 PE=1 SV=1 Back     alignment and function description
>sp|P87185|NFS1_CANAL Cysteine desulfurase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NFS1 PE=3 SV=1 Back     alignment and function description
>sp|P87187|NFS1_CANMA Cysteine desulfurase, mitochondrial OS=Candida maltosa GN=SPL1 PE=3 SV=1 Back     alignment and function description
>sp|A8GNU0|ISCS_RICAH Cysteine desulfurase OS=Rickettsia akari (strain Hartford) GN=iscS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
321474166 426 hypothetical protein DAPPUDRAFT_46336 [D 0.881 0.227 0.845 3e-44
395830354 378 PREDICTED: cysteine desulfurase, mitocho 0.881 0.256 0.814 2e-43
195350957 458 GM26695 [Drosophila sechellia] gi|194123 0.881 0.211 0.845 2e-43
284004919 452 cysteine desulfurase, mitochondrial [Ory 0.881 0.214 0.824 2e-43
344279915 457 PREDICTED: cysteine desulfurase, mitocho 0.881 0.212 0.814 3e-43
20129463 462 CG12264 [Drosophila melanogaster] gi|134 0.881 0.209 0.845 3e-43
197215645 455 NFS1 nitrogen fixation 1 homolog (predic 0.881 0.213 0.814 4e-43
189055336 457 unnamed protein product [Homo sapiens] 0.881 0.212 0.804 5e-43
194861456 458 GG23754 [Drosophila erecta] gi|190661653 0.881 0.211 0.845 5e-43
351702537 457 Cysteine desulfurase, mitochondrial [Het 0.881 0.212 0.824 5e-43
>gi|321474166|gb|EFX85132.1| hypothetical protein DAPPUDRAFT_46336 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 82/97 (84%), Positives = 90/97 (92%)

Query: 1   MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVK 60
           MLPY+TN YGNPHSRTH+YGWESEKAVE AR+++A LIN DPKEIIFTSGATESNNIA+K
Sbjct: 46  MLPYMTNYYGNPHSRTHSYGWESEKAVEVAREQVAKLINADPKEIIFTSGATESNNIAIK 105

Query: 61  GVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNV 97
           GVARFYK KK H+ITTQTEHKCVLDSCR+LEGEGF V
Sbjct: 106 GVARFYKMKKNHIITTQTEHKCVLDSCRVLEGEGFEV 142




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|395830354|ref|XP_003788296.1| PREDICTED: cysteine desulfurase, mitochondrial [Otolemur garnettii] Back     alignment and taxonomy information
>gi|195350957|ref|XP_002042003.1| GM26695 [Drosophila sechellia] gi|194123827|gb|EDW45870.1| GM26695 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|284004919|ref|NP_001164805.1| cysteine desulfurase, mitochondrial [Oryctolagus cuniculus] gi|217038337|gb|ACJ76630.1| NFS1 nitrogen fixation 1 homolog (predicted) [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|344279915|ref|XP_003411731.1| PREDICTED: cysteine desulfurase, mitochondrial-like isoform 1 [Loxodonta africana] Back     alignment and taxonomy information
>gi|20129463|ref|NP_609533.1| CG12264 [Drosophila melanogaster] gi|13431751|sp|Q9VKD3.1|NFS1_DROME RecName: Full=Probable cysteine desulfurase, mitochondrial; Flags: Precursor gi|7297897|gb|AAF53143.1| CG12264 [Drosophila melanogaster] gi|21064277|gb|AAM29368.1| LD22661p [Drosophila melanogaster] gi|220943882|gb|ACL84484.1| CG12264-PA [synthetic construct] gi|220953760|gb|ACL89423.1| CG12264-PA [synthetic construct] Back     alignment and taxonomy information
>gi|197215645|gb|ACH53037.1| NFS1 nitrogen fixation 1 homolog (predicted) [Otolemur garnettii] Back     alignment and taxonomy information
>gi|189055336|dbj|BAG35220.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|194861456|ref|XP_001969786.1| GG23754 [Drosophila erecta] gi|190661653|gb|EDV58845.1| GG23754 [Drosophila erecta] Back     alignment and taxonomy information
>gi|351702537|gb|EHB05456.1| Cysteine desulfurase, mitochondrial [Heterocephalus glaber] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
FB|FBgn0032393 462 CG12264 [Drosophila melanogast 0.881 0.209 0.845 1.7e-41
UNIPROTKB|F1PAY2 457 NFS1 "Uncharacterized protein" 0.881 0.212 0.804 2e-40
UNIPROTKB|B6UV57 457 LOC100739236 "Nitrogen fixatio 0.881 0.212 0.804 2e-40
UNIPROTKB|A5PKG4 457 NFS1 "Uncharacterized protein" 0.881 0.212 0.804 3.3e-40
UNIPROTKB|F2Z2E7204 NFS1 "Cysteine desulfurase, mi 0.881 0.475 0.804 3.3e-40
UNIPROTKB|Q9Y697 457 NFS1 "Cysteine desulfurase, mi 0.881 0.212 0.804 3.3e-40
MGI|MGI:1316706 451 Nfs1 "nitrogen fixation gene 1 0.881 0.215 0.793 3.3e-40
RGD|620912 451 Nfs1 "NFS1 nitrogen fixation 1 0.881 0.215 0.793 3.3e-40
UNIPROTKB|Q3MHT2 459 Nfs1 "Cysteine desulfurase, mi 0.881 0.211 0.793 3.3e-40
UNIPROTKB|F1NNU3 438 LOC100858210 "Uncharacterized 0.881 0.221 0.783 8.7e-40
FB|FBgn0032393 CG12264 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 440 (159.9 bits), Expect = 1.7e-41, P = 1.7e-41
 Identities = 82/97 (84%), Positives = 87/97 (89%)

Query:     1 MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVK 60
             MLPYLTN YGNPHSRTHAYGWE+E AVE AR+++ATLI  DPKEIIFTSGATESNNIAVK
Sbjct:    82 MLPYLTNFYGNPHSRTHAYGWETESAVEKAREQVATLIGADPKEIIFTSGATESNNIAVK 141

Query:    61 GVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNV 97
             GVARFY  KK+HVITTQTEHKCVLDSCR LE EGF V
Sbjct:   142 GVARFYGTKKRHVITTQTEHKCVLDSCRALENEGFKV 178




GO:0016226 "iron-sulfur cluster assembly" evidence=ISS;NAS
GO:0004123 "cystathionine gamma-lyase activity" evidence=ISS;NAS
GO:0005739 "mitochondrion" evidence=ISS;NAS
GO:0005737 "cytoplasm" evidence=ISS
GO:0006523 "alanine biosynthetic process" evidence=ISS
GO:0006534 "cysteine metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0031071 "cysteine desulfurase activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|F1PAY2 NFS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B6UV57 LOC100739236 "Nitrogen fixation 1-like protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A5PKG4 NFS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z2E7 NFS1 "Cysteine desulfurase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y697 NFS1 "Cysteine desulfurase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1316706 Nfs1 "nitrogen fixation gene 1 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620912 Nfs1 "NFS1 nitrogen fixation 1 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHT2 Nfs1 "Cysteine desulfurase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNU3 LOC100858210 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y697NFS1_HUMAN2, ., 8, ., 1, ., 70.80410.88180.2122yesN/A
Q9Z1J3NFS1_MOUSE2, ., 8, ., 1, ., 70.79380.88180.2150yesN/A
Q99P39NFS1_RAT2, ., 8, ., 1, ., 70.79380.88180.2150yesN/A
Q02RW8ISCS_PSEAB2, ., 8, ., 1, ., 70.59180.89090.2425yesN/A
Q60C64ISCS_METCA2, ., 8, ., 1, ., 70.55660.96360.2630yesN/A
Q4UL77ISCS_RICFE2, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
A6V0U8ISCS_PSEA72, ., 8, ., 1, ., 70.59180.89090.2425yesN/A
Q5F8X4ISCS_NEIG12, ., 8, ., 1, ., 70.64940.88180.2400yesN/A
A1KUK1ISCS_NEIMF2, ., 8, ., 1, ., 70.65970.88180.2400yesN/A
O74351NFS1_SCHPO2, ., 8, ., 1, ., 70.75250.88180.1936yesN/A
A3QFD5ISCS_SHELP2, ., 8, ., 1, ., 70.58330.96360.2623yesN/A
A9M029ISCS_NEIM02, ., 8, ., 1, ., 70.65970.88180.2400yesN/A
C3PNQ8ISCS_RICAE2, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
O60028NFS1_ASHGO2, ., 8, ., 1, ., 70.61320.96360.2163yesN/A
A4VNY2ISCS_PSEU52, ., 8, ., 1, ., 70.57400.96360.2623yesN/A
O49543NFS1_ARATH2, ., 8, ., 1, ., 70.74150.80900.1964yesN/A
P25374NFS1_YEAST2, ., 8, ., 1, ., 70.65970.88180.1951yesN/A
Q5RDE7NFS1_PONAB2, ., 8, ., 1, ., 70.80410.88180.2122yesN/A
Q92HP1ISCS_RICCN2, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
A7MU48ISCS_VIBHB2, ., 8, ., 1, ., 70.59250.96360.2623yesN/A
A8F204ISCS_RICM52, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
Q2GGJ4ISCS_EHRCR2, ., 8, ., 1, ., 70.64940.87270.2341yesN/A
Q9HXI8ISCS_PSEAE2, ., 8, ., 1, ., 70.59180.89090.2425yesN/A
Q9ZD60ISCS_RICPR2, ., 8, ., 1, ., 70.62880.88180.2365yesN/A
B4RMB8ISCS_NEIG22, ., 8, ., 1, ., 70.64940.88180.2400yesN/A
Q1RHY6ISCS_RICBR2, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
Q9VKD3NFS1_DROME2, ., 8, ., 1, ., 70.84530.88180.2099yesN/A
Q8DEY7ISCS_VIBVU2, ., 8, ., 1, ., 70.57400.96360.2623yesN/A
A8GNU0ISCS_RICAH2, ., 8, ., 1, ., 70.67010.88180.2365yesN/A
Q68WP6ISCS_RICTY2, ., 8, ., 1, ., 70.63910.88180.2365yesN/A
C4K1Z7ISCS_RICPU2, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
Q9JYY0ISCS_NEIMB2, ., 8, ., 1, ., 70.62880.88180.2400yesN/A
A8GSG4ISCS_RICRS2, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
Q9JTX0ISCS_NEIMA2, ., 8, ., 1, ., 70.65970.88180.2400yesN/A
Q54X04NFS1_DICDI2, ., 8, ., 1, ., 70.67920.96360.2355yesN/A
B0BXX6ISCS_RICRO2, ., 8, ., 1, ., 70.64940.88180.2365yesN/A
A8GWB2ISCS_RICB82, ., 8, ., 1, ., 70.65970.88180.2365yesN/A
B7UWH7ISCS_PSEA82, ., 8, ., 1, ., 70.59180.89090.2425yesN/A
Q8SQS2NFS1_ENCCU2, ., 8, ., 1, ., 70.66660.88180.2245yesN/A
Q9KTY2ISCS_VIBCH2, ., 8, ., 1, ., 70.56480.96360.2623yesN/A
Q486Z0ISCS_COLP32, ., 8, ., 1, ., 70.58330.96360.2623yesN/A
Q87S28ISCS_VIBPA2, ., 8, ., 1, ., 70.58330.96360.2623yesN/A
C3LT01ISCS_VIBCM2, ., 8, ., 1, ., 70.56480.96360.2623yesN/A
Q8EEU9ISCS_SHEON2, ., 8, ., 1, ., 70.59250.96360.2623yesN/A
A5F3G4ISCS_VIBC32, ., 8, ., 1, ., 70.56480.96360.2623yesN/A
Q7MNG2ISCS_VIBVY2, ., 8, ., 1, ., 70.57400.96360.2623yesN/A
A1S544ISCS_SHEAM2, ., 8, ., 1, ., 70.59250.96360.2623yesN/A
A8EYH9ISCS_RICCK2, ., 8, ., 1, ., 70.63460.92720.2487yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
PLN02651 364 PLN02651, PLN02651, cysteine desulfurase 2e-59
PRK14012 404 PRK14012, PRK14012, cysteine desulfurase; Provisio 2e-58
TIGR02006 402 TIGR02006, IscS, cysteine desulfurase IscS 1e-53
COG1104 386 COG1104, NifS, Cysteine sulfinate desulfinase/cyst 6e-48
TIGR03235 353 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA 1e-39
TIGR03402 379 TIGR03402, FeS_nifS, cysteine desulfurase NifS 1e-36
pfam00266 370 pfam00266, Aminotran_5, Aminotransferase class-V 1e-22
TIGR03403 382 TIGR03403, nifS_epsilon, cysteine desulfurase, Nif 8e-19
cd06453 373 cd06453, SufS_like, Cysteine desulfurase (SufS)-li 2e-16
PRK02948 381 PRK02948, PRK02948, cysteine desulfurase; Provisio 1e-15
COG0520 405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 1e-15
TIGR01977 376 TIGR01977, am_tr_V_EF2568, cysteine desulfurase fa 1e-12
TIGR01979 403 TIGR01979, sufS, cysteine desulfurases, SufSfamily 1e-11
TIGR03392 398 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, cat 1e-08
PRK10874 401 PRK10874, PRK10874, cysteine sulfinate desulfinase 5e-08
PLN02724 805 PLN02724, PLN02724, Molybdenum cofactor sulfurase 3e-06
PLN02855 424 PLN02855, PLN02855, Bifunctional selenocysteine ly 3e-06
PRK09295 406 PRK09295, PRK09295, bifunctional cysteine desulfur 6e-04
COG1167 459 COG1167, ARO8, Transcriptional regulators containi 0.001
>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase Back     alignment and domain information
 Score =  185 bits (472), Expect = 2e-59
 Identities = 74/97 (76%), Positives = 82/97 (84%)

Query: 1   MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVK 60
           MLP+L   +GNPHSRTH YGWESE AVE AR ++A LI  DPKEIIFTSGATESNN+A+K
Sbjct: 19  MLPFLIEHFGNPHSRTHLYGWESEDAVEKARAQVAALIGADPKEIIFTSGATESNNLAIK 78

Query: 61  GVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNV 97
           GV  FYK+KKKHVITTQTEHKCVLDSCR L+ EGF V
Sbjct: 79  GVMHFYKDKKKHVITTQTEHKCVLDSCRHLQQEGFEV 115


Length = 364

>gnl|CDD|184450 PRK14012, PRK14012, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS Back     alignment and domain information
>gnl|CDD|224029 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163191 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA Back     alignment and domain information
>gnl|CDD|132443 TIGR03402, FeS_nifS, cysteine desulfurase NifS Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|132444 TIGR03403, nifS_epsilon, cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>gnl|CDD|99746 cd06453, SufS_like, Cysteine desulfurase (SufS)-like Back     alignment and domain information
>gnl|CDD|179511 PRK02948, PRK02948, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131032 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family protein Back     alignment and domain information
>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufSfamily Back     alignment and domain information
>gnl|CDD|132433 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>gnl|CDD|182799 PRK10874, PRK10874, cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>gnl|CDD|215384 PLN02724, PLN02724, Molybdenum cofactor sulfurase Back     alignment and domain information
>gnl|CDD|215460 PLN02855, PLN02855, Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>gnl|CDD|181766 PRK09295, PRK09295, bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>gnl|CDD|224089 COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.93
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.9
KOG1549|consensus 428 99.89
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 99.78
PLN02651 364 cysteine desulfurase 99.77
PRK10874 401 cysteine sulfinate desulfinase; Provisional 99.77
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.75
PRK02948 381 cysteine desulfurase; Provisional 99.74
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 99.74
PLN02724 805 Molybdenum cofactor sulfurase 99.74
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.73
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 99.72
PRK14012 404 cysteine desulfurase; Provisional 99.72
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 99.72
PF00266 371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.71
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.71
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.71
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.66
PLN03032 374 serine decarboxylase; Provisional 99.65
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 99.5
PRK02769 380 histidine decarboxylase; Provisional 99.5
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 99.5
PTZ00094 452 serine hydroxymethyltransferase; Provisional 99.41
COG1167 459 ARO8 Transcriptional regulators containing a DNA-b 99.4
cd00611 355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.35
TIGR01788 431 Glu-decarb-GAD glutamate decarboxylase. This model 99.3
PRK05387 353 histidinol-phosphate aminotransferase; Provisional 99.29
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.27
TIGR01814 406 kynureninase kynureninase. This model describes ky 99.26
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.24
PRK09105 370 putative aminotransferase; Provisional 99.23
PRK04635 354 histidinol-phosphate aminotransferase; Provisional 99.22
PRK14807 351 histidinol-phosphate aminotransferase; Provisional 99.21
PRK05166 371 histidinol-phosphate aminotransferase; Provisional 99.19
TIGR01141 346 hisC histidinol-phosphate aminotransferase. Histid 99.17
PRK01533 366 histidinol-phosphate aminotransferase; Validated 99.17
PLN03026 380 histidinol-phosphate aminotransferase; Provisional 99.14
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.13
PRK08960 387 hypothetical protein; Provisional 99.13
PRK07908 349 hypothetical protein; Provisional 99.11
PRK13520 371 L-tyrosine decarboxylase; Provisional 99.1
PRK01688 351 histidinol-phosphate aminotransferase; Provisional 99.09
PRK03158 359 histidinol-phosphate aminotransferase; Provisional 99.08
PRK00451 447 glycine dehydrogenase subunit 1; Validated 99.08
PRK08153 369 histidinol-phosphate aminotransferase; Provisional 99.07
PRK13355 517 bifunctional HTH-domain containing protein/aminotr 99.07
cd06450 345 DOPA_deC_like DOPA decarboxylase family. This fami 99.07
PRK03321 352 putative aminotransferase; Provisional 99.06
PRK07681 399 aspartate aminotransferase; Provisional 99.05
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.05
TIGR03812 373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.05
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.04
PRK04870 356 histidinol-phosphate aminotransferase; Provisional 99.04
PRK02731 367 histidinol-phosphate aminotransferase; Validated 99.03
PRK14809 357 histidinol-phosphate aminotransferase; Provisional 99.03
PRK06225 380 aspartate aminotransferase; Provisional 99.02
PRK07324 373 transaminase; Validated 99.01
PRK07366 388 succinyldiaminopimelate transaminase; Validated 99.01
PRK06836 394 aspartate aminotransferase; Provisional 99.01
PRK00950 361 histidinol-phosphate aminotransferase; Validated 99.0
PRK03967 337 histidinol-phosphate aminotransferase; Provisional 99.0
PRK09265 404 aminotransferase AlaT; Validated 99.0
PRK07392 360 threonine-phosphate decarboxylase; Validated 99.0
TIGR02326 363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 98.99
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 98.99
PRK05957 389 aspartate aminotransferase; Provisional 98.98
PRK04781 364 histidinol-phosphate aminotransferase; Provisional 98.98
PRK07337 388 aminotransferase; Validated 98.98
PRK08361 391 aspartate aminotransferase; Provisional 98.98
PLN02187 462 rooty/superroot1 98.97
PTZ00377 481 alanine aminotransferase; Provisional 98.97
PTZ00433 412 tyrosine aminotransferase; Provisional 98.97
PRK03317 368 histidinol-phosphate aminotransferase; Provisional 98.96
PRK09148 405 aminotransferase; Validated 98.96
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 98.95
PLN02409 401 serine--glyoxylate aminotransaminase 98.95
PRK15481 431 transcriptional regulatory protein PtsJ; Provision 98.93
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 98.93
PRK07683 387 aminotransferase A; Validated 98.93
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 98.92
PRK05942 394 aspartate aminotransferase; Provisional 98.92
COG0436 393 Aspartate/tyrosine/aromatic aminotransferase [Amin 98.91
PRK06108 382 aspartate aminotransferase; Provisional 98.91
PLN02656 409 tyrosine transaminase 98.91
PRK08912 387 hypothetical protein; Provisional 98.91
PRK06290 410 aspartate aminotransferase; Provisional 98.9
PRK07568 397 aspartate aminotransferase; Provisional 98.9
TIGR01265 403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 98.89
PRK08363 398 alanine aminotransferase; Validated 98.88
PLN00175 413 aminotransferase family protein; Provisional 98.88
PLN02607 447 1-aminocyclopropane-1-carboxylate synthase 98.88
TIGR03537 350 DapC succinyldiaminopimelate transaminase. Note: t 98.88
PRK07550 386 hypothetical protein; Provisional 98.88
PRK08175 395 aminotransferase; Validated 98.87
PRK09276 385 LL-diaminopimelate aminotransferase; Provisional 98.87
PRK02610 374 histidinol-phosphate aminotransferase; Provisional 98.87
TIGR03540 383 DapC_direct LL-diaminopimelate aminotransferase. T 98.86
PRK06348 384 aspartate aminotransferase; Provisional 98.86
PRK08636 403 aspartate aminotransferase; Provisional 98.85
PRK05764 393 aspartate aminotransferase; Provisional 98.85
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 98.84
PLN00145 430 tyrosine/nicotianamine aminotransferase; Provision 98.84
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 98.84
TIGR01264 401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 98.83
PRK14808 335 histidinol-phosphate aminotransferase; Provisional 98.83
PRK06207 405 aspartate aminotransferase; Provisional 98.82
PRK08068 389 transaminase; Reviewed 98.82
PLN02368 407 alanine transaminase 98.82
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 98.81
PRK08637 388 hypothetical protein; Provisional 98.81
TIGR03538 393 DapC_gpp succinyldiaminopimelate transaminase. Thi 98.8
PLN00143 409 tyrosine/nicotianamine aminotransferase; Provision 98.8
PRK08056 356 threonine-phosphate decarboxylase; Provisional 98.8
PRK06358 354 threonine-phosphate decarboxylase; Provisional 98.79
PLN02231 534 alanine transaminase 98.79
PRK06425 332 histidinol-phosphate aminotransferase; Validated 98.79
PRK07682 378 hypothetical protein; Validated 98.78
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 98.78
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 98.78
PRK05839 374 hypothetical protein; Provisional 98.77
PLN02414 993 glycine dehydrogenase (decarboxylating) 98.77
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 98.76
PRK03080 378 phosphoserine aminotransferase; Provisional 98.75
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 98.75
cd00609 350 AAT_like Aspartate aminotransferase family. This f 98.75
PRK07590 409 L,L-diaminopimelate aminotransferase; Validated 98.74
PRK07309 391 aromatic amino acid aminotransferase; Validated 98.74
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 98.74
PRK09147 396 succinyldiaminopimelate transaminase; Provisional 98.74
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 98.73
TIGR03301 355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 98.73
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 98.72
PRK09257 396 aromatic amino acid aminotransferase; Provisional 98.72
PRK12414 384 putative aminotransferase; Provisional 98.72
cd00615 294 Orn_deC_like Ornithine decarboxylase family. This 98.71
PRK06460 376 hypothetical protein; Provisional 98.71
PRK06855 433 aminotransferase; Validated 98.7
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 98.7
PRK07865 364 N-succinyldiaminopimelate aminotransferase; Review 98.69
TIGR03542 402 DAPAT_plant LL-diaminopimelate aminotransferase. T 98.69
TIGR01364 349 serC_1 phosphoserine aminotransferase. This model 98.68
PRK07050 394 cystathionine beta-lyase; Provisional 98.68
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 98.64
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 98.64
PRK07777 387 aminotransferase; Validated 98.63
PRK05367 954 glycine dehydrogenase; Provisional 98.62
PRK09082 386 methionine aminotransferase; Validated 98.61
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 98.6
PRK05664 330 threonine-phosphate decarboxylase; Reviewed 98.58
PLN02721 353 threonine aldolase 98.58
COG0079 356 HisC Histidinol-phosphate/aromatic aminotransferas 98.57
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 98.55
PRK06107 402 aspartate aminotransferase; Provisional 98.53
TIGR03576 346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 98.53
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 98.52
TIGR01140 330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 98.51
KOG0259|consensus 447 98.51
PRK08861 388 cystathionine gamma-synthase; Provisional 98.5
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 98.5
PRK08249 398 cystathionine gamma-synthase; Provisional 98.49
PLN02263 470 serine decarboxylase 98.49
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 98.49
PRK06959 339 putative threonine-phosphate decarboxylase; Provis 98.48
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 98.48
PRK09028 394 cystathionine beta-lyase; Provisional 98.47
PRK08574 385 cystathionine gamma-synthase; Provisional 98.46
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 98.46
PF00155 363 Aminotran_1_2: Aminotransferase class I and II 1-a 98.46
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 98.45
PRK07582 366 cystathionine gamma-lyase; Validated 98.43
PRK08064 390 cystathionine beta-lyase; Provisional 98.43
PTZ00376 404 aspartate aminotransferase; Provisional 98.43
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 98.42
PRK07503 403 methionine gamma-lyase; Provisional 98.42
PRK08045 386 cystathionine gamma-synthase; Provisional 98.41
PRK07179 407 hypothetical protein; Provisional 98.39
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 98.39
PRK09440 416 avtA valine--pyruvate transaminase; Provisional 98.39
PRK05937 370 8-amino-7-oxononanoate synthase; Provisional 98.37
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 98.36
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 98.35
PRK05939 397 hypothetical protein; Provisional 98.34
PRK06234 400 methionine gamma-lyase; Provisional 98.34
PRK08776 405 cystathionine gamma-synthase; Provisional 98.33
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 98.32
PLN02483 489 serine palmitoyltransferase 98.31
PRK08354 311 putative aminotransferase; Provisional 98.3
PLN02672 1082 methionine S-methyltransferase 98.29
PRK05968 389 hypothetical protein; Provisional 98.28
TIGR01437 363 selA_rel uncharacterized pyridoxal phosphate-depen 98.27
KOG0634|consensus 472 98.27
PRK06939 397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 98.26
PRK04366 481 glycine dehydrogenase subunit 2; Validated 98.26
PRK07811 388 cystathionine gamma-synthase; Provisional 98.26
TIGR01366 361 serC_3 phosphoserine aminotransferase, putative. T 98.23
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 98.21
KOG0257|consensus 420 98.2
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 98.2
TIGR00858 360 bioF 8-amino-7-oxononanoate synthase. This model r 98.19
PRK08247 366 cystathionine gamma-synthase; Reviewed 98.17
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 98.15
PRK05967 395 cystathionine beta-lyase; Provisional 98.13
PLN02242 418 methionine gamma-lyase 98.13
PRK06767 386 methionine gamma-lyase; Provisional 98.1
PRK06434 384 cystathionine gamma-lyase; Validated 98.1
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 98.1
KOG0256|consensus 471 98.1
PRK05958 385 8-amino-7-oxononanoate synthase; Reviewed 98.08
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 98.08
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 98.07
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 98.07
PRK09275 527 aspartate aminotransferase; Provisional 98.05
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 98.03
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 98.02
PRK04311 464 selenocysteine synthase; Provisional 98.01
PRK07671 377 cystathionine beta-lyase; Provisional 98.0
PRK07049 427 methionine gamma-lyase; Validated 97.98
PRK10534 333 L-threonine aldolase; Provisional 97.97
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 97.96
PF00282 373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 97.95
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 97.94
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 97.93
PRK05355 360 3-phosphoserine/phosphohydroxythreonine aminotrans 97.92
PRK08114 395 cystathionine beta-lyase; Provisional 97.9
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 97.9
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 97.87
PF12897 425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 97.77
PRK13393 406 5-aminolevulinate synthase; Provisional 97.73
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 97.72
PRK05367 954 glycine dehydrogenase; Provisional 97.69
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 97.67
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 97.65
PRK13392 410 5-aminolevulinate synthase; Provisional 97.63
PLN02822 481 serine palmitoyltransferase 97.63
PLN02509 464 cystathionine beta-lyase 97.62
KOG0258|consensus 475 97.62
COG1103 382 Archaea-specific pyridoxal phosphate-dependent enz 97.59
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 97.55
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 97.54
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 97.48
PF01212 290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 97.42
PRK13578 720 ornithine decarboxylase; Provisional 97.4
PLN02271 586 serine hydroxymethyltransferase 97.36
PRK15029 755 arginine decarboxylase; Provisional 97.35
PRK07269 364 cystathionine gamma-synthase; Reviewed 97.33
PLN02880 490 tyrosine decarboxylase 97.32
PRK15399 713 lysine decarboxylase LdcC; Provisional 97.29
PLN02590 539 probable tyrosine decarboxylase 97.29
PRK15400 714 lysine decarboxylase CadA; Provisional 97.28
TIGR01821 402 5aminolev_synth 5-aminolevulinic acid synthase. Th 97.27
PLN02397 423 aspartate transaminase 97.24
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 97.23
PRK13034 416 serine hydroxymethyltransferase; Reviewed 97.1
COG0075 383 Serine-pyruvate aminotransferase/archaeal aspartat 97.08
PRK12566 954 glycine dehydrogenase; Provisional 97.02
COG2008 342 GLY1 Threonine aldolase [Amino acid transport and 96.93
KOG2862|consensus 385 96.92
COG1168 388 MalY Bifunctional PLP-dependent enzyme with beta-c 96.87
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 96.87
TIGR01365 374 serC_2 phosphoserine aminotransferase, Methanosarc 96.84
COG0626 396 MetC Cystathionine beta-lyases/cystathionine gamma 96.79
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 96.62
PRK09064 407 5-aminolevulinate synthase; Validated 96.54
PF02347 429 GDC-P: Glycine cleavage system P-protein; InterPro 96.47
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 96.47
PF00464 399 SHMT: Serine hydroxymethyltransferase; InterPro: I 96.42
PLN03226 475 serine hydroxymethyltransferase; Provisional 96.19
PRK07505 402 hypothetical protein; Provisional 96.16
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 96.04
KOG0633|consensus 375 95.92
COG0112 413 GlyA Glycine/serine hydroxymethyltransferase [Amin 95.67
PLN02452 365 phosphoserine transaminase 95.38
TIGR00707 379 argD acetylornithine and succinylornithine aminotr 95.2
PRK03244 398 argD acetylornithine aminotransferase; Provisional 94.98
PRK01278 389 argD acetylornithine transaminase protein; Provisi 94.82
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 94.77
PRK12462 364 phosphoserine aminotransferase; Provisional 94.75
KOG0053|consensus 409 94.34
KOG1368|consensus 384 94.16
TIGR00713 423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 93.78
PF06838 403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 93.76
PLN02955 476 8-amino-7-oxononanoate synthase 93.74
PRK02627 396 acetylornithine aminotransferase; Provisional 93.63
PRK13237 460 tyrosine phenol-lyase; Provisional 92.9
COG1184 301 GCD2 Translation initiation factor 2B subunit, eIF 92.39
COG1003 496 GcvP Glycine cleavage system protein P (pyridoxal- 91.42
PRK04260 375 acetylornithine aminotransferase; Provisional 90.43
COG3844 407 Kynureninase [Amino acid transport and metabolism] 90.24
KOG2142|consensus 728 89.94
COG4100 416 Cystathionine beta-lyase family protein involved i 89.82
COG0156 388 BioF 7-keto-8-aminopelargonate synthetase and rela 89.49
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 89.35
PF04864 363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 88.89
PRK02936 377 argD acetylornithine aminotransferase; Provisional 87.88
KOG1383|consensus 491 87.87
PRK13580 493 serine hydroxymethyltransferase; Provisional 87.58
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 87.4
PRK04013 364 argD acetylornithine/acetyl-lysine aminotransferas 87.14
PRK00062 426 glutamate-1-semialdehyde aminotransferase; Provisi 86.71
PF0128284 Ribosomal_S24e: Ribosomal protein S24e; InterPro: 86.6
PRK08117 433 4-aminobutyrate aminotransferase; Provisional 83.59
PRK10494259 hypothetical protein; Provisional 83.55
PTZ00125 400 ornithine aminotransferase-like protein; Provision 83.04
COG1932 365 SerC Phosphoserine aminotransferase [Coenzyme meta 83.03
COG0403 450 GcvP Glycine cleavage system protein P (pyridoxal- 82.85
KOG1403|consensus 452 81.4
COG4992 404 ArgD Ornithine/acetylornithine aminotransferase [A 80.97
PRK07523 255 gluconate 5-dehydrogenase; Provisional 80.33
PRK12403 460 putative aminotransferase; Provisional 80.07
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
Probab=99.93  E-value=1e-25  Score=162.12  Aligned_cols=108  Identities=55%  Similarity=0.868  Sum_probs=98.6

Q ss_pred             ChhhhhhhcCCCCCcCChHHHHHHHHHHHHHHHHHHHhCCCCCcEEEeCChHHHHHHHHHHhHHhhc--cCCCEEEEcCC
Q psy17798          1 MLPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYK--EKKKHVITTQT   78 (110)
Q Consensus         1 ~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~R~~la~~l~~~~~~i~~t~gat~a~~~i~~~l~~~~~--~~g~~vl~~~~   78 (110)
                      |.+|++..|+||++ .|.+|+.+.+.++++|+.||+++|++|++|+||+|+||++|+++.+......  ++|.+||++.+
T Consensus        21 m~~~~~~~fgNPsS-~H~~G~~A~~~ve~AR~~iA~llga~~~eIiFTSG~TEsnNlaI~g~~~a~~~~~~~~HIIts~i   99 (386)
T COG1104          21 MLPYLTEVFGNPSS-LHSFGREARKAVEEAREQIAKLLGADPEEIIFTSGATESNNLAIKGAALAYRNAQKGKHIITSAI   99 (386)
T ss_pred             HHHHHHhhcCCccc-hhHhHHHHHHHHHHHHHHHHHHhCCCCCeEEEecCCcHHHHHHHHhhHHhhhcccCCCeEEEccc
Confidence            46788889999998 9999999999999999999999999999999999999999999999543221  36889999999


Q ss_pred             CChhHHHHHHHHHhCCcEEEEecCCCCcccc
Q psy17798         79 EHKCVLDSCRILEGEGFNVLGSNPGQGGNFL  109 (110)
Q Consensus        79 e~ps~~~~~~~l~~~g~~v~~v~~~~~G~~~  109 (110)
                      |||+++.+.+.+++.|++|+++|+|++|.++
T Consensus       100 EH~aVl~~~~~Le~~g~~Vtyl~V~~~G~v~  130 (386)
T COG1104         100 EHPAVLNTCRYLERQGFEVTYLPVDSNGLVD  130 (386)
T ss_pred             ccHHHHHHHHHHHhcCCeEEEeCCCCCCeEc
Confidence            9999999999998889999999999999986



>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2142|consensus Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PF01282 Ribosomal_S24e: Ribosomal protein S24e; InterPro: IPR001976 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK10494 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1403|consensus Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
3lvj_A 423 Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 4e-32
1p3w_B 404 X-Ray Crystal Structure Of E. Coli Iscs Length = 40 4e-32
4eb5_A 382 A. Fulgidus Iscs-Iscu Complex Structure Length = 38 1e-20
3vax_A 400 Crytal Structure Of Dnda From Streptomyces Lividans 1e-19
1ecx_A 384 Nifs-Like Protein Length = 384 7e-16
1eg5_A 384 Nifs-like Protein Length = 384 1e-14
3gzd_A 440 Human Selenocysteine Lyase, P1 Crystal Form Length 1e-08
3gzc_A 440 Structure Of Human Selenocysteine Lyase Length = 44 1e-08
3a9x_A 432 Crystal Structure Of Rat Selenocysteine Lyase Lengt 4e-08
1t3i_A 420 Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE De 4e-04
>pdb|3LVJ|A Chain A, Crystal Structure Of E.Coli Iscs-Tusa Complex (Form 1) Length = 423 Back     alignment and structure

Iteration: 1

Score = 132 bits (333), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 59/108 (54%), Positives = 83/108 (76%), Gaps = 2/108 (1%) Query: 1 MLPYLT--NAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIA 58 M+ ++T +GNP SR+H +GW++E+AV+ AR +IA L+ DP+EI+FTSGATES+N+A Sbjct: 42 MMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLA 101 Query: 59 VKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGG 106 +KG A FY++K KH+IT++TEHK VLD+CR LE EGF V P + G Sbjct: 102 IKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNG 149
>pdb|1P3W|B Chain B, X-Ray Crystal Structure Of E. Coli Iscs Length = 404 Back     alignment and structure
>pdb|4EB5|A Chain A, A. Fulgidus Iscs-Iscu Complex Structure Length = 382 Back     alignment and structure
>pdb|3VAX|A Chain A, Crytal Structure Of Dnda From Streptomyces Lividans Length = 400 Back     alignment and structure
>pdb|1ECX|A Chain A, Nifs-Like Protein Length = 384 Back     alignment and structure
>pdb|1EG5|A Chain A, Nifs-like Protein Length = 384 Back     alignment and structure
>pdb|3GZD|A Chain A, Human Selenocysteine Lyase, P1 Crystal Form Length = 440 Back     alignment and structure
>pdb|3GZC|A Chain A, Structure Of Human Selenocysteine Lyase Length = 440 Back     alignment and structure
>pdb|3A9X|A Chain A, Crystal Structure Of Rat Selenocysteine Lyase Length = 432 Back     alignment and structure
>pdb|1T3I|A Chain A, Structure Of Slr0077SUFS, THE ESSENTIAL CYSTEINE Desulfurase From Synechocystis Pcc 6803 Length = 420 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 3e-66
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 3e-64
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 4e-64
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 3e-57
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 6e-14
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 3e-13
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 2e-11
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 3e-11
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 1e-10
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 2e-05
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 6e-05
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 4e-04
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Length = 423 Back     alignment and structure
 Score =  204 bits (521), Expect = 3e-66
 Identities = 57/99 (57%), Positives = 80/99 (80%), Gaps = 2/99 (2%)

Query: 1   MLPYLT--NAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIA 58
           M+ ++T    +GNP SR+H +GW++E+AV+ AR +IA L+  DP+EI+FTSGATES+N+A
Sbjct: 42  MMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLA 101

Query: 59  VKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNV 97
           +KG A FY++K KH+IT++TEHK VLD+CR LE EGF V
Sbjct: 102 IKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEV 140


>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Length = 382 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Length = 384 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Length = 432 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Length = 390 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Length = 406 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Length = 420 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Length = 406 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Length = 416 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Length = 465 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Length = 381 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 99.69
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 99.65
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 99.63
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.62
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 99.6
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.58
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 99.58
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 99.52
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.52
3e77_A 377 Phosphoserine aminotransferase; SERC, PLP, structu 99.45
1iug_A 352 Putative aspartate aminotransferase; wild type, py 99.43
3qm2_A 386 Phosphoserine aminotransferase; structural genomic 99.4
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.34
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.3
3m5u_A 361 Phosphoserine aminotransferase; alpha-beta half sa 99.28
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.28
3ly1_A 354 Putative histidinol-phosphate aminotransferase; st 99.27
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.23
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 99.23
3ffh_A 363 Histidinol-phosphate aminotransferase; APC88260, l 99.22
3hdo_A 360 Histidinol-phosphate aminotransferase; PSI-II, his 99.21
1fg7_A 356 Histidinol phosphate aminotransferase; HISC, histi 99.2
3get_A 365 Histidinol-phosphate aminotransferase; NP_281508.1 99.19
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 99.18
3p1t_A 337 Putative histidinol-phosphate aminotransferase; PL 99.17
3euc_A 367 Histidinol-phosphate aminotransferase 2; YP_297314 99.17
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 99.16
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.16
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.16
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 99.15
2fnu_A 375 Aminotransferase; protein-product complex, structu 99.15
1vjo_A 393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.14
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.12
1o69_A 394 Aminotransferase; structural genomics, unknown fun 99.12
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.11
1svv_A 359 Threonine aldolase; structural genomics, structura 99.1
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 99.09
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 99.09
3ez1_A 423 Aminotransferase MOCR family; YP_604413.1, struct 99.08
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 99.08
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.08
1w23_A 360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.08
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.07
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 99.07
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.05
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 99.05
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.05
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.04
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.03
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 99.03
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.03
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.02
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 99.02
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 99.02
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.02
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 99.01
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.01
3fkd_A 350 L-threonine-O-3-phosphate decarboxylase; structura 99.01
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.0
3d6k_A 422 Putative aminotransferase; APC82464, corynebacteri 99.0
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 99.0
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 99.0
3ele_A 398 Amino transferase; RER070207001803, structural gen 99.0
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.0
1vp4_A 425 Aminotransferase, putative; structural genomics, j 98.99
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 98.99
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 98.98
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 98.98
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 98.98
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 98.97
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 98.96
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 98.96
1uu1_A 335 Histidinol-phosphate aminotransferase; histidine b 98.96
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 98.95
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 98.95
1bw0_A 416 TAT, protein (tyrosine aminotransferase); tyrosine 98.95
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 98.94
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 98.94
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 98.94
2c0r_A 362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 98.94
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 98.94
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 98.93
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 98.93
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 98.93
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 98.93
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 98.92
3bwn_A 391 AT1G70560, L-tryptophan aminotransferase; auxin sy 98.92
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 98.91
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 98.91
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 98.91
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 98.91
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 98.91
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 98.91
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 98.9
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 98.89
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 98.89
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 98.89
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 98.89
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 98.89
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 98.88
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 98.88
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 98.88
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 98.88
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 98.87
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 98.87
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 98.86
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 98.86
1lc5_A 364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 98.86
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 98.86
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 98.86
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 98.86
3op7_A 375 Aminotransferase class I and II; PLP-dependent tra 98.86
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 98.85
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 98.85
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 98.85
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 98.85
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 98.85
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 98.85
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 98.84
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 98.84
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 98.84
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 98.83
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 98.83
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 98.83
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 98.82
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 98.82
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 98.81
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 98.81
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 98.81
2bwn_A 401 5-aminolevulinate synthase; tetrapyrrole biosynthe 98.81
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 98.81
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 98.81
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 98.81
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 98.8
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 98.8
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 98.8
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 98.8
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 98.79
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 98.79
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 98.78
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 98.78
2hox_A 427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 98.78
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 98.78
3asa_A 400 LL-diaminopimelate aminotransferase; PLP dependent 98.77
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 98.77
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 98.76
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 98.75
3nra_A 407 Aspartate aminotransferase; structural genomics, j 98.75
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 98.75
3rq1_A 418 Aminotransferase class I and II; structural genomi 98.74
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 98.74
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 98.73
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 98.72
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 98.71
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 98.71
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 98.71
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 98.7
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 98.68
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 98.68
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 98.67
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 98.67
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 98.67
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 98.66
2fyf_A 398 PSAT, phosphoserine aminotransferase; PLP-dependen 98.64
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 98.55
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 98.55
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 98.55
1bs0_A 384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 98.53
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 98.5
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 98.48
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 98.47
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 98.46
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 98.43
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 98.43
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 98.42
1fc4_A 401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 98.41
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 98.4
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 98.38
3b1d_A 392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 97.73
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 98.34
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.34
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 98.32
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 98.29
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.26
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 98.25
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 98.25
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 98.23
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 98.21
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 98.13
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 98.13
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.13
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 98.11
3pj0_A 359 LMO0305 protein; structural genomics, joint center 98.11
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 98.11
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 98.08
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 98.07
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 97.93
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 97.84
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 97.8
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 97.78
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 97.7
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 97.66
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 97.66
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 97.62
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 97.54
1z7d_A 433 Ornithine aminotransferase; structural genomics co 97.46
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 97.38
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 97.36
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 97.31
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 97.29
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.18
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 97.15
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 97.11
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 97.09
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.07
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 97.06
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 97.04
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.03
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.03
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 96.99
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 96.9
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 96.89
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 96.88
4h51_A 420 Aspartate aminotransferase; ssgcid, structural gen 96.86
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 96.85
3hmu_A 472 Aminotransferase, class III; structural genomics, 96.71
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 96.61
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 96.32
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 95.05
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 94.62
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 94.21
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 88.54
2yky_A 465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 88.18
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 83.63
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 83.29
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 82.38
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 82.13
1xn9_A101 30S ribosomal protein S24E; beta+alpha, GFT struct 81.7
1ywx_A102 30S ribosomal protein S24E; GFT MRR16, nesgc, stru 81.34
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
Probab=99.69  E-value=6.9e-16  Score=108.54  Aligned_cols=106  Identities=39%  Similarity=0.688  Sum_probs=92.6

Q ss_pred             hhhhhhcCCCCCcCChHHHHHHHHHHHHHHHHHHHhCCCCCcEEEeCChHHHHHHHHHHhHHhhccCCCEEEEcCCCChh
Q psy17798          3 PYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEHKC   82 (110)
Q Consensus         3 ~~~~~~~~n~~~~~~~~~~~~~~~~~~~R~~la~~l~~~~~~i~~t~gat~a~~~i~~~l~~~~~~~g~~vl~~~~e~ps   82 (110)
                      +++...++||+. .|..++...+.++++|+.+|+++++++++|++|+|+++|+.++++++.....++||+|+++..+||+
T Consensus        22 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~la~~~~~~~~~i~~~~g~~~a~~~~~~~~~~~~~~~gd~vi~~~~~~~~  100 (382)
T 4hvk_A           22 PYMTESFGNPSS-VHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGYAMRNARKGKHILVSAVEHMS  100 (382)
T ss_dssp             HHHHTSCCCTTC-SSHHHHHHHHHHHHHHHHHHHHTTCTTEEEEEESSHHHHHHHHHHHHHHHHGGGCCEEEEETTCCHH
T ss_pred             HHHHhhcCCCcc-cchHHHHHHHHHHHHHHHHHHHcCCCcCeEEEECCchHHHHHHHHHhhhhhcCCCCEEEECCCCcHH
Confidence            455567889987 7888888889999999999999999999999999999999999998863223689999999999999


Q ss_pred             HHHHHHHHHhCCcEEEEecCCCCcccc
Q psy17798         83 VLDSCRILEGEGFNVLGSNPGQGGNFL  109 (110)
Q Consensus        83 ~~~~~~~l~~~g~~v~~v~~~~~G~~~  109 (110)
                      +...+..++..|++++.+|++++|.+|
T Consensus       101 ~~~~~~~~~~~g~~~~~v~~~~~~~~d  127 (382)
T 4hvk_A          101 VINPAKFLQKQGFEVEYIPVGKYGEVD  127 (382)
T ss_dssp             HHHHHHHHHHTTCEEEEECBCTTSCBC
T ss_pred             HHHHHHHHHhcCCEEEEeccCCCCCcC
Confidence            999988887889999999999887654



>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1xn9_A 30S ribosomal protein S24E; beta+alpha, GFT structural genomics, protein structure initiative, PSI, NESG, MAR11; NMR {Methanosarcina mazei} SCOP: d.12.1.3 Back     alignment and structure
>1ywx_A 30S ribosomal protein S24E; GFT MRR16, nesgc, structural genomics, PSI, protein structure initiative; NMR {Methanococcus maripaludis} SCOP: d.12.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d1p3wa_ 391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 1e-31
d1eg5a_ 376 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 1e-25
d1jf9a_ 405 c.67.1.3 (A:) NifS-like protein/selenocysteine lya 2e-22
d1t3ia_ 408 c.67.1.3 (A:) Probable cysteine desulfurase SufS { 5e-19
d2bkwa1 382 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransfe 4e-15
d1elua_ 381 c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocyst 8e-15
d1svva_ 340 c.67.1.1 (A:) Low-specificity threonine aldolase { 6e-13
d1qz9a_ 404 c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescen 5e-10
d1m32a_ 361 c.67.1.3 (A:) 2-aminoethylphosphonate transaminase 4e-09
d1c4ka2 462 c.67.1.5 (A:108-569) Ornithine decarboxylase major 2e-08
d1v72a1 345 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Ps 4e-08
d1vjoa_ 377 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 5e-06
d2ch1a1 388 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminas 6e-06
d3bc8a1 445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 1e-04
d1h0ca_ 388 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 3e-04
d1pmma_ 450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 0.004
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: Cysteine desulfurase IscS
species: Escherichia coli [TaxId: 562]
 Score =  112 bits (280), Expect = 1e-31
 Identities = 59/108 (54%), Positives = 83/108 (76%), Gaps = 2/108 (1%)

Query: 1   MLPYLT--NAYGNPHSRTHAYGWESEKAVEDARQEIATLINCDPKEIIFTSGATESNNIA 58
           M+ ++T    +GNP SR+H +GW++E+AV+ AR +IA L+  DP+EI+FTSGATES+N+A
Sbjct: 22  MMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLA 81

Query: 59  VKGVARFYKEKKKHVITTQTEHKCVLDSCRILEGEGFNVLGSNPGQGG 106
           +KG A FY++K KH+IT++TEHK VLD+CR LE EGF V    P + G
Sbjct: 82  IKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNG 129


>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Length = 376 Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 408 Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 382 Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Length = 381 Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Length = 340 Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Length = 404 Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Length = 361 Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Length = 345 Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Length = 377 Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Length = 388 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 99.86
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 99.84
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.84
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 99.8
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.7
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.21
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.2
d1fg7a_ 354 Histidinol-phosphate aminotransferase HisC {Escher 99.19
d1vp4a_ 420 Putative aminotransferase TM1131 {Thermotoga marit 99.01
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 99.0
d1bw0a_ 412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 98.97
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.97
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.96
d2r5ea1 418 Kynurenine--oxoglutarate transaminase I {Yellowfev 98.93
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 98.92
d1d2fa_ 361 Modulator in mal gene expression, MalY {Escherichi 98.88
d1b5pa_ 382 Aspartate aminotransferase, AAT {Thermus thermophi 98.88
d1j32a_ 388 Aspartate aminotransferase, AAT {Phormidium lapide 98.88
d1svva_ 340 Low-specificity threonine aldolase {Leishmania maj 98.85
d2bkwa1 382 Alanine-glyoxylate aminotransferase {Baker's yeast 98.84
d1gdea_ 388 Aromatic aminoacid aminotransferase, AroAT {Archae 98.81
d2f8ja1 334 Histidinol-phosphate aminotransferase HisC {Thermo 98.76
d2gb3a1 389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 98.76
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 98.74
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 98.73
d2ch1a1 388 3-hydroxykynurenine transaminase {Malaria mosquito 98.72
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 98.71
d1m32a_ 361 2-aminoethylphosphonate transaminase {Salmonella t 98.7
d1u08a_ 382 Putative methionine aminotransferase YdbL {Escheri 98.68
d1c7na_ 394 Cystalysin {Treponema denticola [TaxId: 158]} 98.68
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 98.64
d1xi9a_ 395 Putative alanine aminotransferase {Pyrococcus furi 98.62
d1bjna_ 360 Phosphoserine aminotransferase, PSAT {Escherichia 98.53
d2c0ra1 361 Phosphoserine aminotransferase, PSAT {Bacillus cir 98.52
d1vjoa_ 377 Alanine-glyoxylate aminotransferase {Cyanobacteria 98.52
d1o4sa_ 375 Aspartate aminotransferase, AAT {Thermotoga mariti 98.5
d1w7la_ 418 Kynurenine--oxoglutarate transaminase I {Human (Ho 98.42
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 98.41
d1iuga_ 348 Subgroup IV putative aspartate aminotransferase {T 98.38
d1w23a_ 360 Phosphoserine aminotransferase, PSAT {Bacillus alc 98.37
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 98.31
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 98.24
d1lc5a_ 355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 98.23
d3tata_ 397 Aromatic aminoacid aminotransferase, AroAT {Escher 98.11
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 98.06
d7aata_ 401 Aspartate aminotransferase, AAT {Chicken (Gallus g 98.03
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 97.95
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 97.95
d2hoxa1 425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 97.94
d1gc0a_ 392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 97.84
d1js3a_ 476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 97.68
d1y4ia1 397 Methionine gamma-lyase, MGL {Citrobacter freundii 97.38
d1cl1a_ 391 Cystathionine beta-lyase, CBL {Escherichia coli [T 97.37
d1qgna_ 398 Cystathionine gamma-synthase, CGS {Common tobacco 97.3
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 97.26
d1pffa_ 331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 97.22
d2ay1a_ 394 Aromatic aminoacid aminotransferase, AroAT {Paraco 97.2
d1e5ea_ 394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 97.15
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 97.11
d2q7wa1 396 Aspartate aminotransferase, AAT {Escherichia coli 97.06
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 96.98
d1fc4a_ 401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 96.79
d1yaaa_ 412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 96.7
d1ajsa_ 412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 96.6
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 96.48
d1cs1a_ 384 Cystathionine gamma-synthase, CGS {Escherichia col 96.45
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 96.39
d1dfoa_ 416 Serine hydroxymethyltransferase {Escherichia coli 96.39
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 96.23
d1wyua1 437 Glycine dehydrogenase (decarboxylating) subunit 1 96.21
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 95.78
d1n8pa_ 393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 95.16
d2bwna1 396 5-aminolevulinate synthase {Rhodobacter capsulatus 94.5
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 94.49
d1kl1a_ 405 Serine hydroxymethyltransferase {Bacillus stearoth 94.0
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 93.73
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 93.43
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 85.43
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 85.22
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.74
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 84.63
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 83.75
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 82.85
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 82.53
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Cystathionine synthase-like
domain: NifS-like protein/selenocysteine lyase
species: Escherichia coli [TaxId: 562]
Probab=99.86  E-value=2.9e-21  Score=137.92  Aligned_cols=108  Identities=19%  Similarity=0.319  Sum_probs=97.5

Q ss_pred             hhhhhhhcCCCCCcCChHHHHHHHHHHHHHHHHHHHhCC-CCCcEEEeCChHHHHHHHHHHhHHhhccCCCEEEEcCCCC
Q psy17798          2 LPYLTNAYGNPHSRTHAYGWESEKAVEDARQEIATLINC-DPKEIIFTSGATESNNIAVKGVARFYKEKKKHVITTQTEH   80 (110)
Q Consensus         2 ~~~~~~~~~n~~~~~~~~~~~~~~~~~~~R~~la~~l~~-~~~~i~~t~gat~a~~~i~~~l~~~~~~~g~~vl~~~~e~   80 (110)
                      .+|+++.++||+++.|..++.+.+.++++|+.+|+++|+ ++++|+||+|+|++++.++.++....+++|++|+++..||
T Consensus        43 ~~~~~~~~~n~~~~~~~~~~~~~~~~e~~R~~ia~~l~~~~~~~i~~~~~~T~~~~~~~~~~~~~~~~~g~~il~~~~e~  122 (405)
T d1jf9a_          43 AEFYRHGYAAVHRGIHTLSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQMEH  122 (405)
T ss_dssp             HHHHHHTCCCCSSCSSHHHHHHHHHHHHHHHHHHHHTTCSCGGGEEEESSHHHHHHHHHHHHHHHHCCTTCEEEEETTCC
T ss_pred             HHHHHhccCCCccchhHHHHHHHHHHHHHHHHHHHHcCCCCcccccccCcHHHHHHHHHhcccccccCCCCEEEEEeCcc
Confidence            467888999999888999999999999999999999997 5689999999999999999886543458999999999999


Q ss_pred             hhHHHHHHHH-HhCCcEEEEecCCCCcccc
Q psy17798         81 KCVLDSCRIL-EGEGFNVLGSNPGQGGNFL  109 (110)
Q Consensus        81 ps~~~~~~~l-~~~g~~v~~v~~~~~G~~~  109 (110)
                      |++..+|+.+ ++.|++|+++|++++|.+|
T Consensus       123 ~s~~~~~~~~a~~~g~~v~~~~~~~~g~~~  152 (405)
T d1jf9a_         123 HANIVPWQMLCARVGAELRVIPLNPDGTLQ  152 (405)
T ss_dssp             GGGTHHHHHHHHHHTCEEEEECBCTTSCBC
T ss_pred             cchHHHHHHHHHHcCcEEEEECCCCCCcCC
Confidence            9999999999 6779999999999999876



>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure