Diaphorina citri psyllid: psy17810


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKGIPHNLQEGQDS
cccccHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
******AITSQLDKASIIRLTISYLKLRDFSG******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKGIPHNLQEGQDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein trachealess Transcription factor, master regulator of tracheal cell fates in the embryo, necessary for the development of the salivary gland duct and the posterior spiracles. It may induce a general fate of branched tubular structures of epithelial origin. Heterodimers of tgo/trh are involved in the control of breathless expression.very confidentQ24119
Neuronal PAS domain-containing protein 3 May play a broad role in neurogenesis. May control regulatory pathways relevant to schizophrenia and to psychotic illness.confidentQ9QZQ0
Neuronal PAS domain-containing protein 3 May play a broad role in neurogenesis. May control regulatory pathways relevant to schizophrenia and to psychotic illness.confidentQ8IXF0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0035176 [BP]social behaviorprobableGO:0050896, GO:0007610, GO:0008150, GO:0051703, GO:0051705, GO:0051704
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0035277 [BP]spiracle morphogenesis, open tracheal systemprobableGO:0032502, GO:0007424, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0007626 [BP]locomotory behaviorprobableGO:0044708, GO:0050896, GO:0008150, GO:0007610
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0001657 [BP]ureteric bud developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0001655, GO:0048731, GO:0035295, GO:0072001, GO:0007275, GO:0044699
GO:0032364 [BP]oxygen homeostasisprobableGO:0033483, GO:0048878, GO:0042592, GO:0008150, GO:0065007, GO:0065008
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0007443 [BP]Malpighian tubule morphogenesisprobableGO:0032502, GO:0061326, GO:0048619, GO:0055123, GO:0009790, GO:0048565, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0048598, GO:0061333, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0061525, GO:0008150, GO:0001655, GO:0072002, GO:0072001, GO:0007442, GO:0044707, GO:0048856, GO:0035295, GO:0048731, GO:0048546
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0042711 [BP]maternal behaviorprobableGO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0060746, GO:0033057, GO:0000003, GO:0051704
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0046886 [BP]positive regulation of hormone biosynthetic processprobableGO:0009889, GO:0032352, GO:0019222, GO:0032350, GO:0031326, GO:0031325, GO:0031328, GO:0031323, GO:0050794, GO:0065007, GO:0046885, GO:0048518, GO:0008150, GO:0048522, GO:0009891, GO:0050789, GO:0009893
GO:0043619 [BP]regulation of transcription from RNA polymerase II promoter in response to oxidative stressprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0006357, GO:0065007, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0008150, GO:0051171, GO:2001141, GO:0042221, GO:0034599, GO:0006979, GO:0043620, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0033554, GO:0044763
GO:0010575 [BP]positive regulation vascular endothelial growth factor productionprobableGO:0051240, GO:0010574, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789, GO:0001819
GO:0010573 [BP]vascular endothelial growth factor productionprobableGO:0001816, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0000988 [MF]protein binding transcription factor activityprobableGO:0003674
GO:0051879 [MF]Hsp90 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0072175 [BP]epithelial tube formationprobableGO:0032502, GO:0002009, GO:0048856, GO:0035239, GO:0044707, GO:0060429, GO:0009888, GO:0035148, GO:0044767, GO:0032501, GO:0008150, GO:0044699, GO:0048729, GO:0060562, GO:0035295, GO:0009653, GO:0007275, GO:0048646
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674
GO:0021979 [BP]hypothalamus cell differentiationprobableGO:0032502, GO:0021536, GO:0048856, GO:0007420, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0044763, GO:0030900, GO:0044767, GO:0007399, GO:0048513, GO:0021854, GO:0008150, GO:0021761, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0007417
GO:0051402 [BP]neuron apoptotic processprobableGO:0010259, GO:0009987, GO:0070997, GO:0006915, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0097285, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3L, chain A
Confidence level:confident
Coverage over the Query: 1-34
View the alignment between query and template
View the model in PyMOL