Psyllid ID: psy17810


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKGIPHNLQEGQDS
cccccHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
cccccHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHcccc
mlplpaaitsqLDKASIIRLTISYLKlrdfsghgdppwsrdgpspsksvkgiphnlqegqds
mlplpaaitsqldkASIIRLTISYLKLRDFSGHGdppwsrdgpspsksvkgiphnlqegqds
MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKGIPHNLQEGQDS
***********LDKASIIRLTISYLKLRDF********************************
******AITSQLDKASIIRLTISYLKLRDFSG******************************
MLPLPAAITSQLDKASIIRLTISYLKLRDFSGH*****************GIPHNLQEGQDS
MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWS***********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKGIPHNLQEGQDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query62 2.2.26 [Sep-21-2011]
Q24119 1022 Protein trachealess OS=Dr yes N/A 0.661 0.040 0.951 8e-17
Q9QZQ0 925 Neuronal PAS domain-conta yes N/A 0.822 0.055 0.754 6e-16
Q8IXF0 933 Neuronal PAS domain-conta yes N/A 0.838 0.055 0.740 2e-15
Q99742 590 Neuronal PAS domain-conta no N/A 0.725 0.076 0.577 4e-09
P97459 594 Neuronal PAS domain-conta no N/A 0.612 0.063 0.657 5e-09
Q61079 657 Single-minded homolog 2 O no N/A 0.903 0.085 0.580 5e-07
Q14190 667 Single-minded homolog 2 O no N/A 0.677 0.062 0.666 7e-07
P05709 697 Protein single-minded OS= no N/A 0.451 0.040 0.857 1e-06
P81133 766 Single-minded homolog 1 O no N/A 0.451 0.036 0.857 1e-06
A2T6X9 766 Single-minded homolog 1 O no N/A 0.451 0.036 0.857 1e-06
>sp|Q24119|TRH_DROME Protein trachealess OS=Drosophila melanogaster GN=trh PE=1 SV=4 Back     alignment and function desciption
 Score = 85.5 bits (210), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 41/41 (100%)

Query: 1   MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRD 41
           MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPW+R+
Sbjct: 112 MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWTRE 152




Transcription factor, master regulator of tracheal cell fates in the embryo, necessary for the development of the salivary gland duct and the posterior spiracles. It may induce a general fate of branched tubular structures of epithelial origin. Heterodimers of tgo/trh are involved in the control of breathless expression.
Drosophila melanogaster (taxid: 7227)
>sp|Q9QZQ0|NPAS3_MOUSE Neuronal PAS domain-containing protein 3 OS=Mus musculus GN=Npas3 PE=2 SV=1 Back     alignment and function description
>sp|Q8IXF0|NPAS3_HUMAN Neuronal PAS domain-containing protein 3 OS=Homo sapiens GN=NPAS3 PE=2 SV=1 Back     alignment and function description
>sp|Q99742|NPAS1_HUMAN Neuronal PAS domain-containing protein 1 OS=Homo sapiens GN=NPAS1 PE=2 SV=2 Back     alignment and function description
>sp|P97459|NPAS1_MOUSE Neuronal PAS domain-containing protein 1 OS=Mus musculus GN=Npas1 PE=1 SV=1 Back     alignment and function description
>sp|Q61079|SIM2_MOUSE Single-minded homolog 2 OS=Mus musculus GN=Sim2 PE=1 SV=1 Back     alignment and function description
>sp|Q14190|SIM2_HUMAN Single-minded homolog 2 OS=Homo sapiens GN=SIM2 PE=1 SV=2 Back     alignment and function description
>sp|P05709|SIM_DROME Protein single-minded OS=Drosophila melanogaster GN=sim PE=1 SV=3 Back     alignment and function description
>sp|P81133|SIM1_HUMAN Single-minded homolog 1 OS=Homo sapiens GN=SIM1 PE=2 SV=2 Back     alignment and function description
>sp|A2T6X9|SIM1_PANTR Single-minded homolog 1 OS=Pan troglodytes GN=SIM1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
307182730 965 Protein trachealess [Camponotus floridan 0.822 0.052 0.960 2e-20
307202142 927 Protein trachealess [Harpegnathos saltat 0.822 0.055 0.941 1e-19
270015606 851 trachealess [Tribolium castaneum] 0.822 0.059 0.901 3e-19
189241974 820 PREDICTED: similar to Bm trachealess [Tr 0.822 0.062 0.901 4e-19
350424337 907 PREDICTED: protein trachealess-like isof 0.822 0.056 0.901 5e-19
340722623 907 PREDICTED: protein trachealess-like isof 0.822 0.056 0.901 5e-19
350424334 935 PREDICTED: protein trachealess-like isof 0.822 0.054 0.901 5e-19
340722621 990 PREDICTED: protein trachealess-like isof 0.822 0.051 0.901 6e-19
332027679 953 Protein trachealess [Acromyrmex echinati 0.822 0.053 0.942 6e-19
345485710 681 PREDICTED: protein trachealess-like [Nas 0.806 0.073 0.94 7e-19
>gi|307182730|gb|EFN69854.1| Protein trachealess [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 49/51 (96%)

Query: 1   MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKG 51
           MLPLPAAITSQLDKASIIRLTISYLKLRDFS HGDPPWSRDGP PSKSVKG
Sbjct: 111 MLPLPAAITSQLDKASIIRLTISYLKLRDFSSHGDPPWSRDGPPPSKSVKG 161




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307202142|gb|EFN81642.1| Protein trachealess [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270015606|gb|EFA12054.1| trachealess [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189241974|ref|XP_967112.2| PREDICTED: similar to Bm trachealess [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350424337|ref|XP_003493762.1| PREDICTED: protein trachealess-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722623|ref|XP_003399703.1| PREDICTED: protein trachealess-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424334|ref|XP_003493761.1| PREDICTED: protein trachealess-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722621|ref|XP_003399702.1| PREDICTED: protein trachealess-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332027679|gb|EGI67747.1| Protein trachealess [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345485710|ref|XP_001606407.2| PREDICTED: protein trachealess-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
FB|FBgn0262139 1022 trh "trachealess" [Drosophila 0.758 0.045 0.893 1.6e-16
UNIPROTKB|I3LMD4205 NPAS3 "Uncharacterized protein 0.838 0.253 0.740 4.7e-16
UNIPROTKB|F1NJ7082 F1NJ70 "Uncharacterized protei 0.806 0.609 0.75 6e-16
MGI|MGI:1351610 925 Npas3 "neuronal PAS domain pro 0.822 0.055 0.754 2.7e-15
UNIPROTKB|F8VR32 938 NPAS3 "Neuronal PAS domain-con 0.822 0.054 0.754 2.8e-15
UNIPROTKB|F8VS42 906 NPAS3 "Neuronal PAS domain-con 0.838 0.057 0.740 9e-15
UNIPROTKB|F6VP83 913 NPAS3 "Uncharacterized protein 0.838 0.056 0.740 9.1e-15
UNIPROTKB|F7HC48 932 NPAS3 "Uncharacterized protein 0.838 0.055 0.740 9.4e-15
UNIPROTKB|Q8IXF0 933 NPAS3 "Neuronal PAS domain-con 0.838 0.055 0.740 9.4e-15
ZFIN|ZDB-GENE-060503-934 770 npas3b "neuronal PAS domain pr 0.903 0.072 0.620 4.3e-12
FB|FBgn0262139 trh "trachealess" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 1.6e-16, P = 1.6e-16
 Identities = 42/47 (89%), Positives = 44/47 (93%)

Query:     1 MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSK 47
             MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPW+R+  S SK
Sbjct:   112 MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWTREASSSSK 158




GO:0072175 "epithelial tube formation" evidence=IMP
GO:0005634 "nucleus" evidence=ISS;NAS;IDA;TAS
GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS
GO:0007424 "open tracheal system development" evidence=NAS;IMP;TAS
GO:0007431 "salivary gland development" evidence=NAS;IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=TAS;IPI
GO:0035277 "spiracle morphogenesis, open tracheal system" evidence=IMP
GO:0007443 "Malpighian tubule morphogenesis" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;TAS;IPI
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS
GO:0007425 "epithelial cell fate determination, open tracheal system" evidence=IMP;TAS
GO:0007435 "salivary gland morphogenesis" evidence=IMP;TAS
GO:0004871 "signal transducer activity" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|I3LMD4 NPAS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ70 F1NJ70 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1351610 Npas3 "neuronal PAS domain protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F8VR32 NPAS3 "Neuronal PAS domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VS42 NPAS3 "Neuronal PAS domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6VP83 NPAS3 "Uncharacterized protein" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|F7HC48 NPAS3 "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IXF0 NPAS3 "Neuronal PAS domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-934 npas3b "neuronal PAS domain protein 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8IXF0NPAS3_HUMANNo assigned EC number0.74070.83870.0557yesN/A
Q9QZQ0NPAS3_MOUSENo assigned EC number0.75470.82250.0551yesN/A
Q24119TRH_DROMENo assigned EC number0.95120.66120.0401yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
KOG3558|consensus 768 99.54
KOG3559|consensus 598 99.32
KOG3560|consensus 712 99.23
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 95.25
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 95.07
smart0035353 HLH helix loop helix domain. 94.94
>KOG3558|consensus Back     alignment and domain information
Probab=99.54  E-value=2.6e-15  Score=121.52  Aligned_cols=56  Identities=59%  Similarity=0.895  Sum_probs=43.0

Q ss_pred             CCCCchHHhhccchhhhhHhhHHHHHHHHhhcCCCCCCCCCCCCCCCcccCcccccc
Q psy17810          1 MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKGIPHNLQ   57 (62)
Q Consensus         1 lLPlp~~v~s~LDKaSImRLtisyLr~r~~~~~~~~~w~~~~~~~~~t~~lgshlLQ   57 (62)
                      +||||++|++||||||||||||||||||+|+.+++++ ...++.++.-.-.+.|.||
T Consensus        71 ~lPlp~aisshLDkaSimRLtISyLRlrk~a~~g~~p-~~e~~~~~~e~~l~~~iLq  126 (768)
T KOG3558|consen   71 LLPLPAAISSHLDKASIMRLTISYLRLRKFAGAGDPP-RAEGEPENLEQHLGDHILQ  126 (768)
T ss_pred             hCCCcchhhhhhhhHHHHHHHHHHHHHHHHhhcCCcc-cccCCCcchhhhhhhhHHh
Confidence            5999999999999999999999999999999999765 2233333322235566665



>KOG3559|consensus Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 2e-13
4f3l_A 361 Mclock, circadian locomoter output cycles protein 3e-10
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
 Score = 61.2 bits (148), Expect = 2e-13
 Identities = 7/39 (17%), Positives = 22/39 (56%)

Query: 1  MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWS 39
          ++P   A++ +LDK +++R+ + ++K    + +     +
Sbjct: 38 LVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEAN 76


>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 98.32
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.05
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 97.98
4h10_B71 Circadian locomoter output cycles protein kaput; B 96.23
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 91.92
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 91.89
1hlo_A80 Protein (transcription factor MAX); transcriptiona 91.86
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 90.55
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 90.38
4ati_A118 MITF, microphthalmia-associated transcription fact 87.83
1a0a_A63 BHLH, protein (phosphate system positive regulator 83.17
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
Probab=98.32  E-value=4.6e-08  Score=58.76  Aligned_cols=38  Identities=18%  Similarity=0.250  Sum_probs=25.3

Q ss_pred             CCCchHHhhccchhhhhHhhHHHHHHHHhhcCCCCCCC
Q psy17810          2 LPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWS   39 (62)
Q Consensus         2 LPlp~~v~s~LDKaSImRLtisyLr~r~~~~~~~~~w~   39 (62)
                      +|......+++|||+|++.||.|||...+|..++.+|.
T Consensus        35 vP~~~~~~~KldKasIL~~tV~ylk~l~~~~~~~~~~~   72 (73)
T 4h10_A           35 VPTCNAMSRKLDKLTVLRMAVQHMKTLRGAWLEHHHHH   72 (73)
T ss_dssp             SHHHHTCSSCCCHHHHHHHHHHHHHHHSCC--------
T ss_pred             ccccccccccccHHHHHHHHHHHHHHHhcCcccCCccC
Confidence            44444456899999999999999999999999887663



>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 93.78
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 91.98
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 90.35
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 89.13
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 88.55
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 82.79
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 82.65
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myod B/HLH domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=93.78  E-value=0.0094  Score=32.99  Aligned_cols=24  Identities=25%  Similarity=0.400  Sum_probs=18.7

Q ss_pred             CCCCchHHhhccchhhhhHhhHHHHH
Q psy17810          1 MLPLPAAITSQLDKASIIRLTISYLK   26 (62)
Q Consensus         1 lLPlp~~v~s~LDKaSImRLtisyLr   26 (62)
                      +||-.+  ...+||++|++.+|.|++
T Consensus        37 llP~~~--~~k~sK~~iL~~Ai~YI~   60 (68)
T d1mdya_          37 STSSNP--NQRLPKVEILRNAIRYIE   60 (68)
T ss_dssp             TSCSCT--TSCCCHHHHHHHHHHHHH
T ss_pred             HCCCCC--CCCCCHHHHHHHHHHHHH
Confidence            355433  358999999999999995



>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure