Diaphorina citri psyllid: psy17819

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MFSQIRKMSTAKSFKIALVQMTVGKDKNKNLENAVRFIRKAADNGASLIVLPECFNCPYGTKYFREYSEEIGSGITSKTLSNVAKEKEIFLVGGSIPELDNDKVYNAATVHLFDIAIPGGITFKESDVLSPGNSFSMFNNGICNIGLGICYDMRFPELAQVYRKKGCDLLIYPGAFNMTTGPLHWELLVRSRANDNQVYVAACSPAQDKNSDYIAWGHSTVVDPWANILATSQFEETIVYADIDLNTLNKVRDQIPTGKQKRYDLYDVTAKL
ccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEccccccccccccHHHHccccccccHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccEEEcccccccccccEEEEccccEEEEEEEcccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHccEEEEEEcccccccccccccccEEEEcccccHHHccccccEEEEEEccHHHHHHHHHHcccccccccccccccccc
*************FKIALVQMTVGKDKNKNLENAVRFIRKAADNGASLIVLPECFNCPYGTKYFREYSEEIGSGITSKTLSNVAKEKEIFLVGGSIPELDNDKVYNAATVHLFDIAIPGGITFKESDVLSPGNSFSMFNNGICNIGLGICYDMRFPELAQVYRKKGCDLLIYPGAFNMTTGPLHWELLVRSRANDNQVYVAACSPAQDKNSDYIAWGHSTVVDPWANILATSQFEETIVYADIDLNTLNKVRDQIPTGKQKRYDLYDVTAKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSQIRKMSTAKSFKIALVQMTVGKDKNKNLENAVRFIRKAADNGASLIVLPECFNCPYGTKYFREYSEEIGSGITSKTLSNVAKEKEIFLVGGSIPELDNDKVYNAATVHLFDIAIPGGITFKESDVLSPGNSFSMFNNGICNIGLGICYDMRFPELAQVYRKKGCDLLIYPGAFNMTTGPLHWELLVRSRANDNQVYVAACSPAQDKNSDYIAWGHSTVVDPWANILATSQFEETIVYADIDLNTLNKVRDQIPTGKQKRYDLYDVTAKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Omega-amidase NIT2 Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively.very confidentQ5R4L6
Omega-amidase NIT2 Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.very confidentQ9NQR4
Omega-amidase NIT2 Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively.very confidentQ2T9R6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005813 [CC]centrosomeconfidentGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050152 [MF]omega-amidase activityprobableGO:0016787, GO:0016810, GO:0016811, GO:0003674, GO:0003824
GO:0006139 [BP]nucleobase-containing compound metabolic processprobableGO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0000257 [MF]nitrilase activityprobableGO:0016787, GO:0016810, GO:0003674, GO:0003824, GO:0016815
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0047710 [MF]bis(5'-adenosyl)-triphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674, GO:0004551
GO:0046686 [BP]response to cadmium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.1.-11-cis-retinol dehydrogenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F89, chain A
Confidence level:very confident
Coverage over the Query: 10-112,123-263
View the alignment between query and template
View the model in PyMOL