Diaphorina citri psyllid: psy17820


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
cccccccccEEEEEEEcccccccEEEEEEEcccEEEEEECccccccCECcccccccccccEEEEEEccccEEEEECccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEcccEEEEECccccccccEEEEcccCEEEEEcccccccccccccccEEEEEEEcccccccEEEccccEEEEEcccHHHHHHHHHHHccc
*HTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytohesin-1 Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP.confidentQ15438
Cytohesin-1 Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP.confidentQ9QX11
Cytohesin-1 Promotes guanine-nucleotide exchange on ARF6. Promotes the activation of ARF6 through replacement of GDP with GTP.confidentP97694

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0090162 [BP]establishment of epithelial cell polarityprobableGO:0009987, GO:0007163, GO:0008150, GO:0030010, GO:0044763, GO:0044699
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0045785 [BP]positive regulation of cell adhesionprobableGO:0030155, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005547 [MF]phosphatidylinositol-3,4,5-trisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005086 [MF]ARF guanyl-nucleotide exchange factor activityprobableGO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0032012 [BP]regulation of ARF protein signal transductionprobableGO:0051056, GO:0009966, GO:0048583, GO:0046578, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FGY, chain A
Confidence level:very confident
Coverage over the Query: 96-209
View the alignment between query and template
View the model in PyMOL
Template: 2R09, chain A
Confidence level:very confident
Coverage over the Query: 49-209
View the alignment between query and template
View the model in PyMOL
Template: 3TFM, chain A
Confidence level:very confident
Coverage over the Query: 5-109,131-167,188-210
View the alignment between query and template
View the model in PyMOL