Psyllid ID: psy17820


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
cccccccccEEEEEEEcccccccEEEEEEEcccEEEEEEEccccccEEEcccccccccccEEEEEEccccEEEEEEccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEcccEEEEEEccccccccEEEEcccEEEEEEcccccccccccccccEEEEEEEcccccccEEEccccEEEEEcccHHHHHHHHHHHccc
ccccccccEEEEEEEEccccccEEEEEEEEEccEEEEEccccccccccccccccccccEEEEEEEEEccEEEEEccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEEccEEEEEcccccccccEEEEccccEEEEEcccccccEEEEEcccccccccEEEcccccEEEccccEEEEEcccHHHHHHHHHHHccc
mhtffnpdkegwlwkqggrykswkRRWFILNDKCLYYFeyttdksaclienssgrykswKRRWFILNDKCLYyfeyttdkpfkipeddgndlmhtffnpdkegwlwkqggrykswkRRWFILNDKCLYYfeyttdkeprgiipleniqvrevhdrhkphcfelfTSGFEFIKacktdsegkvvegkHTVYRMSAATAEEKDEWIKCLSLH
mhtffnpdkegwlwkqggrykswkrRWFILNDKCLYYFEYTtdksaclienssgrykswkrrWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTffnpdkegwlwKQGGRYKSWKRRWFILNDKCLYYFEyttdkeprgiiPLENIQVREVHDRHKPHCFELFTSGFEFIKACKtdsegkvvegkHTVYRmsaataeekdewikclslh
MHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
********KEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAA******EWIKC****
*HTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDK************KSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
MHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
**TFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKSACLIENSSGRYKSWKRRWFILNDKCLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query210 2.2.26 [Sep-21-2011]
Q76MY7399 Cytohesin-2 OS=Chlorocebu N/A N/A 0.642 0.338 0.686 8e-54
Q15438398 Cytohesin-1 OS=Homo sapie yes N/A 0.638 0.336 0.700 9e-54
Q76MZ1398 Cytohesin-1 OS=Chlorocebu N/A N/A 0.638 0.336 0.700 9e-54
P97694398 Cytohesin-1 OS=Rattus nor yes N/A 0.638 0.336 0.693 2e-53
Q9QX11398 Cytohesin-1 OS=Mus muscul yes N/A 0.638 0.336 0.693 2e-53
O08967399 Cytohesin-3 OS=Mus muscul no N/A 0.638 0.335 0.676 4e-53
P63034400 Cytohesin-2 OS=Mus muscul no N/A 0.857 0.45 0.533 6e-53
P63035400 Cytohesin-2 OS=Rattus nor no N/A 0.857 0.45 0.533 8e-53
Q99418400 Cytohesin-2 OS=Homo sapie no N/A 0.642 0.337 0.681 2e-52
P97696400 Cytohesin-3 OS=Rattus nor no N/A 0.638 0.335 0.671 9e-52
>sp|Q76MY7|CYH2_CHLAE Cytohesin-2 OS=Chlorocebus aethiops GN=CYTH2 PE=2 SV=1 Back     alignment and function desciption
 Score =  209 bits (533), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 94/137 (68%), Positives = 111/137 (81%), Gaps = 2/137 (1%)

Query: 74  FEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYT 133
           ++   ++PFKIPEDDGNDL HTFFNPD+EGWL K GGR K+WKRRWFIL D CLYYFEYT
Sbjct: 235 YDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYT 294

Query: 134 TDKEPRGIIPLENIQVREVHDRHKPHCFELFTSG--FEFIKACKTDSEGKVVEGKHTVYR 191
           TDKEPRGIIPLEN+ +REV D  KP+CFEL+      + IKACKT+++G+VVEG H VYR
Sbjct: 295 TDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYR 354

Query: 192 MSAATAEEKDEWIKCLS 208
           +SA T EEKDEWIK + 
Sbjct: 355 ISAPTQEEKDEWIKSIQ 371




Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane.
Chlorocebus aethiops (taxid: 9534)
>sp|Q15438|CYH1_HUMAN Cytohesin-1 OS=Homo sapiens GN=CYTH1 PE=1 SV=1 Back     alignment and function description
>sp|Q76MZ1|CYH1_CHLAE Cytohesin-1 OS=Chlorocebus aethiops GN=CYTH1 PE=2 SV=1 Back     alignment and function description
>sp|P97694|CYH1_RAT Cytohesin-1 OS=Rattus norvegicus GN=Cyth1 PE=1 SV=1 Back     alignment and function description
>sp|Q9QX11|CYH1_MOUSE Cytohesin-1 OS=Mus musculus GN=Cyth1 PE=2 SV=2 Back     alignment and function description
>sp|O08967|CYH3_MOUSE Cytohesin-3 OS=Mus musculus GN=Cyth3 PE=1 SV=1 Back     alignment and function description
>sp|P63034|CYH2_MOUSE Cytohesin-2 OS=Mus musculus GN=Cyth2 PE=1 SV=2 Back     alignment and function description
>sp|P63035|CYH2_RAT Cytohesin-2 OS=Rattus norvegicus GN=Cyth2 PE=1 SV=1 Back     alignment and function description
>sp|Q99418|CYH2_HUMAN Cytohesin-2 OS=Homo sapiens GN=CYTH2 PE=1 SV=2 Back     alignment and function description
>sp|P97696|CYH3_RAT Cytohesin-3 OS=Rattus norvegicus GN=Cyth3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
307167289 441 Cytohesin-1 [Camponotus floridanus] 0.652 0.310 0.868 2e-68
380019731 434 PREDICTED: cytohesin-1-like isoform 1 [A 0.652 0.315 0.868 4e-68
340716420 434 PREDICTED: cytohesin-1-like isoform 1 [B 0.652 0.315 0.868 4e-68
350424580 414 PREDICTED: cytohesin-1-like [Bombus impa 0.895 0.454 0.645 4e-68
340716422 418 PREDICTED: cytohesin-1-like isoform 2 [B 0.895 0.449 0.645 4e-68
383860355 434 PREDICTED: cytohesin-1-like [Megachile r 0.652 0.315 0.868 5e-68
345497545 436 PREDICTED: cytohesin-1-like [Nasonia vit 0.652 0.314 0.868 5e-68
332028459 333 Cytohesin-1 [Acromyrmex echinatior] 0.638 0.402 0.888 1e-67
307206275 324 Cytohesin-1 [Harpegnathos saltator] 0.895 0.580 0.64 4e-67
242024260 371 Cytohesin-1, putative [Pediculus humanus 0.895 0.506 0.63 4e-67
>gi|307167289|gb|EFN60957.1| Cytohesin-1 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 119/137 (86%), Positives = 126/137 (91%)

Query: 71  LYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYF 130
           +  +E    +PFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILND CLYYF
Sbjct: 276 VSLYESIKTEPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYF 335

Query: 131 EYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVY 190
           EYTTDKEPRGIIPLENIQVRE+ DRHKPHCFEL+ +G EFIKACKTDSEGKVVEGKHTVY
Sbjct: 336 EYTTDKEPRGIIPLENIQVREIQDRHKPHCFELYAAGSEFIKACKTDSEGKVVEGKHTVY 395

Query: 191 RMSAATAEEKDEWIKCL 207
           RMSAAT EEKDEWIKC+
Sbjct: 396 RMSAATDEEKDEWIKCV 412




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380019731|ref|XP_003693756.1| PREDICTED: cytohesin-1-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|340716420|ref|XP_003396696.1| PREDICTED: cytohesin-1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424580|ref|XP_003493843.1| PREDICTED: cytohesin-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716422|ref|XP_003396697.1| PREDICTED: cytohesin-1-like isoform 2 [Bombus terrestris] gi|380019733|ref|XP_003693757.1| PREDICTED: cytohesin-1-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|383860355|ref|XP_003705656.1| PREDICTED: cytohesin-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345497545|ref|XP_001600284.2| PREDICTED: cytohesin-1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332028459|gb|EGI68502.1| Cytohesin-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307206275|gb|EFN84340.1| Cytohesin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242024260|ref|XP_002432546.1| Cytohesin-1, putative [Pediculus humanus corporis] gi|212518006|gb|EEB19808.1| Cytohesin-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
FB|FBgn0086779727 step "steppke" [Drosophila mel 0.642 0.185 0.838 5.4e-63
UNIPROTKB|B7Z1T4339 CYTH1 "Cytohesin-1" [Homo sapi 0.638 0.395 0.700 3.5e-52
UNIPROTKB|Q15438398 CYTH1 "Cytohesin-1" [Homo sapi 0.638 0.336 0.700 3.5e-52
UNIPROTKB|F1PKP6400 CYTH1 "Uncharacterized protein 0.638 0.335 0.700 3.5e-52
UNIPROTKB|F1RZ72398 CYTH1 "Uncharacterized protein 0.638 0.336 0.700 5.6e-52
UNIPROTKB|F1P496386 CYTH3 "Uncharacterized protein 0.638 0.347 0.691 7.2e-52
MGI|MGI:1334257398 Cyth1 "cytohesin 1" [Mus muscu 0.638 0.336 0.693 7.2e-52
RGD|620397398 Cyth1 "cytohesin 1" [Rattus no 0.638 0.336 0.693 7.2e-52
UNIPROTKB|P97694398 Cyth1 "Cytohesin-1" [Rattus no 0.638 0.336 0.693 7.2e-52
UNIPROTKB|F1RL83399 CYTH2 "Uncharacterized protein 0.638 0.335 0.691 1.2e-51
FB|FBgn0086779 step "steppke" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 643 (231.4 bits), Expect = 5.4e-63, P = 5.4e-63
 Identities = 114/136 (83%), Positives = 122/136 (89%)

Query:    74 FEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYT 133
             +E    +PFKIP+DDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILND CLYYFEYT
Sbjct:   569 YESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYT 628

Query:   134 TDKEPRGIIPLENIQVREVHDRHKPHCFELF-TSGFEFIKACKTDSEGKVVEGKHTVYRM 192
             TDKEPRGIIPLENI VRE+HDR KPHCFELF T G + IKACKTDSEGKVVEGKHTVYRM
Sbjct:   629 TDKEPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRM 688

Query:   193 SAATAEEKDEWIKCLS 208
             SAAT E++ EWIK L+
Sbjct:   689 SAATEEDQQEWIKRLT 704


GO:0005086 "ARF guanyl-nucleotide exchange factor activity" evidence=ISS;IBA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0032012 "regulation of ARF protein signal transduction" evidence=IEA
GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP
GO:0005802 "trans-Golgi network" evidence=IBA
GO:0005886 "plasma membrane" evidence=IBA
GO:0016192 "vesicle-mediated transport" evidence=IBA
GO:0030155 "regulation of cell adhesion" evidence=IBA
UNIPROTKB|B7Z1T4 CYTH1 "Cytohesin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15438 CYTH1 "Cytohesin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKP6 CYTH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZ72 CYTH1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P496 CYTH3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1334257 Cyth1 "cytohesin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620397 Cyth1 "cytohesin 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P97694 Cyth1 "Cytohesin-1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RL83 CYTH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q15438CYH1_HUMANNo assigned EC number0.70070.63800.3366yesN/A
Q9QX11CYH1_MOUSENo assigned EC number0.69340.63800.3366yesN/A
P97694CYH1_RATNo assigned EC number0.69340.63800.3366yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
cd01252118 cd01252, PH_GRP1-like, General Receptor for Phosph 1e-75
cd01252118 cd01252, PH_GRP1-like, General Receptor for Phosph 3e-26
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 2e-23
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 9e-20
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 1e-16
pfam00169101 pfam00169, PH, PH domain 2e-15
smart00233102 smart00233, PH, Pleckstrin homology domain 2e-15
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 7e-15
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 1e-14
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 9e-14
cd13260103 cd13260, PH_RASA1, RAS p21 protein activator (GTPa 2e-13
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 5e-13
cd1057396 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin 2e-12
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 4e-11
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 5e-11
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 7e-11
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 9e-11
cd13302109 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin 2e-10
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 2e-10
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 3e-10
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 4e-10
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 7e-10
cd13378116 cd13378, PH_RhoGAP2, Rho GTPase activating protein 1e-09
cd1325393 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky 2e-09
cd13281139 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) doma 4e-09
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 5e-09
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 7e-09
cd13379114 cd13379, PH_RhoGap24, Rho GTPase activating protei 8e-08
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 1e-07
cd13308113 cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple 1e-07
cd13298106 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin 1e-07
cd1331695 cd13316, PH_Boi, Boi family Pleckstrin homology do 1e-07
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 2e-07
cd01241121 cd01241, PH_PKB, Protein Kinase B-like pleckstrin 2e-07
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 2e-07
cd13309103 cd13309, PH_SKIP, SifA and kinesin-interacting pro 2e-07
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 3e-07
cd01238140 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr 5e-07
cd1323790 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain 6e-07
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 7e-07
cd01233111 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein p 8e-07
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 9e-07
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 1e-06
cd13299102 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin 1e-06
cd01241121 cd01241, PH_PKB, Protein Kinase B-like pleckstrin 2e-06
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 3e-06
cd1323790 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain 3e-06
cd01260114 cd01260, PH_CNK_mammalian-like, Connector enhancer 4e-06
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 5e-06
cd01263119 cd01263, PH_anillin, Anillin Pleckstrin homology ( 5e-06
cd13252125 cd13252, PH1_ADAP, ArfGAP with dual PH domains Ple 6e-06
pfam00169101 pfam00169, PH, PH domain 7e-06
cd1057396 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin 8e-06
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 1e-05
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 2e-05
cd1327991 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) d 3e-05
cd13272116 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bis 3e-05
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 4e-05
cd13379114 cd13379, PH_RhoGap24, Rho GTPase activating protei 5e-05
cd01218123 cd01218, PH_Phafin2-like, Phafin2 (also called EAP 6e-05
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 7e-05
cd13308113 cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple 7e-05
smart00233102 smart00233, PH, Pleckstrin homology domain 8e-05
cd1331695 cd13316, PH_Boi, Boi family Pleckstrin homology do 9e-05
cd01244107 cd01244, PH_GAP1-like, RAS p21 protein activator ( 9e-05
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 1e-04
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 1e-04
cd1332690 cd13326, PH_CNK_insect-like, Connector enhancer of 1e-04
cd13278139 cd13278, PH_Bud4, Bud4 Pleckstrin homology (PH) do 2e-04
cd1329388 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxys 2e-04
cd01259124 cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor p 3e-04
cd13380106 cd13380, PH_Skap1, Src kinase-associated phosphopr 3e-04
cd1325393 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky 4e-04
cd01238140 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr 4e-04
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 8e-04
cd13260103 cd13260, PH_RASA1, RAS p21 protein activator (GTPa 9e-04
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 0.001
cd01260114 cd01260, PH_CNK_mammalian-like, Connector enhancer 0.001
cd13266106 cd13266, PH_Skap_family, Src kinase-associated pho 0.001
cd01257106 cd01257, PH_IRS, Insulin receptor substrate (IRS) 0.001
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 0.002
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 0.002
cd1329388 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxys 0.002
cd13389125 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain 0.002
cd13267125 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub 0.002
cd13292103 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol bin 0.002
cd13278139 cd13278, PH_Bud4, Bud4 Pleckstrin homology (PH) do 0.003
cd13277111 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) P 0.003
cd01239127 cd01239, PH_PKD, Protein kinase D (PKD/PKCmu) plec 0.003
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 0.004
cd13378116 cd13378, PH_RhoGAP2, Rho GTPase activating protein 0.004
cd1323790 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain 0.004
cd13275103 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interac 0.004
cd13275103 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interac 0.004
cd1328499 cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro 0.004
cd1328499 cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro 0.004
>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain Back     alignment and domain information
 Score =  222 bits (569), Expect = 1e-75
 Identities = 86/111 (77%), Positives = 93/111 (83%)

Query: 97  FNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRH 156
           FNPD+EGWL K GGR KSWKRRWFIL D CLYYFEYTTDKEPRGIIPLEN+ VREV D  
Sbjct: 1   FNPDREGWLLKLGGRVKSWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSVREVEDSK 60

Query: 157 KPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCL 207
           KP CFEL++   E IKACKTDS+GKVVEG HTVYR+SAAT EE DEWIK +
Sbjct: 61  KPFCFELYSPSNEVIKACKTDSDGKVVEGNHTVYRISAATEEEMDEWIKSI 111


GRP1/cytohesin3 and the related proteins ARNO (ARF nucleotide-binding site opener)/cytohesin-2 and cytohesin-1 are ARF exchange factors that contain a pleckstrin homology (PH) domain thought to target these proteins to cell membranes through binding polyphosphoinositides. The PH domains of all three proteins exhibit relatively high affinity for PtdIns(3,4,5)P3. Within the Grp1 family, diglycine (2G) and triglycine (3G) splice variants, differing only in the number of glycine residues in the PH domain, strongly influence the affinity and specificity for phosphoinositides. The 2G variants selectively bind PtdIns(3,4,5)P3 with high affinity,the 3G variants bind PtdIns(3,4,5)P3 with about 30-fold lower affinity and require the polybasic region for plasma membrane targeting. These ARF-GEFs share a common, tripartite structure consisting of an N-terminal coiled-coil domain, a central domain with homology to the yeast protein Sec7, a PH domain, and a C-terminal polybasic region. The Sec7 domain is autoinhibited by conserved elements proximal to the PH domain. GRP1 binds to the DNA binding domain of certain nuclear receptors (TRalpha, TRbeta, AR, ER, but not RXR), and can repress thyroid hormone receptor (TR)-mediated transactivation by decreasing TR-complex formation on thyroid hormone response elements. ARNO promotes sequential activation of Arf6, Cdc42 and Rac1 and insulin secretion. Cytohesin acts as a PI 3-kinase effector mediating biological responses including cell spreading and adhesion, chemotaxis, protein trafficking, and cytoskeletal rearrangements, only some of which appear to depend on their ability to activate ARFs. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 118

>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating protein) 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing, family D (with coiled-coil domains) member 1 PH domain Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241463 cd13309, PH_SKIP, SifA and kinesin-interacting protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241453 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus Back     alignment and domain information
>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241406 cd13252, PH1_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241433 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate 4-phosphatase and Type II inositol 3,4-bisphosphate 4-phosphatase Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241277 cd01244, PH_GAP1-like, RAS p21 protein activator (GTPase activating protein) family pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241432 cd13278, PH_Bud4, Bud4 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding protein related protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241290 cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating protein) 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241288 cd01257, PH_IRS, Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding protein related protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241540 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein homologs 1 and 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241432 cd13278, PH_Bud4, Bud4 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241431 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241272 cd01239, PH_PKD, Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus Back     alignment and domain information
>gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 210
KOG0930|consensus395 100.0
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.91
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.91
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.9
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.89
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.89
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.88
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.88
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.87
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.86
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.85
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.85
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.84
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.83
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.83
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.82
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.78
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.77
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.76
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.75
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 99.74
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.69
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.66
PF1540989 PH_8: Pleckstrin homology domain 99.66
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.62
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.62
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.6
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.59
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.58
KOG0930|consensus395 99.58
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.58
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.56
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.56
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.55
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.54
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.52
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.5
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.49
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.48
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.48
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.48
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.47
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.46
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 99.43
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.42
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.4
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 99.4
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.36
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.33
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.29
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.28
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.22
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.21
KOG0248|consensus 936 99.21
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 99.19
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 99.15
PF1540989 PH_8: Pleckstrin homology domain 99.11
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 99.1
KOG1117|consensus 1186 99.06
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 99.05
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 99.03
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.03
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.03
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.01
KOG0690|consensus 516 98.98
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.97
KOG1090|consensus1732 98.95
KOG3640|consensus1116 98.92
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 98.89
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.81
KOG2059|consensus 800 98.68
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 98.62
KOG3751|consensus 622 98.61
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 98.59
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 98.57
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.55
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.51
KOG0521|consensus 785 98.49
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 98.49
KOG0932|consensus 774 98.47
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 98.44
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.37
PTZ00267478 NIMA-related protein kinase; Provisional 98.36
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 98.31
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 98.29
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 98.24
KOG1090|consensus1732 98.2
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 98.19
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 98.18
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.11
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 98.08
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 98.03
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 97.97
KOG3531|consensus1036 97.96
KOG1451|consensus 812 97.93
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 97.93
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 97.88
KOG0690|consensus 516 97.84
PLN02866 1068 phospholipase D 97.84
KOG1117|consensus 1186 97.84
KOG0248|consensus 936 97.79
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 97.79
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 97.79
KOG3751|consensus 622 97.76
KOG1739|consensus 611 97.73
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.72
KOG3723|consensus851 97.65
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 97.6
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.59
KOG4424|consensus 623 97.55
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 97.52
KOG3543|consensus 1218 97.48
PF15406112 PH_6: Pleckstrin homology domain 97.42
PTZ00283496 serine/threonine protein kinase; Provisional 97.41
PF15408104 PH_7: Pleckstrin homology domain 97.37
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 97.31
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 97.28
PF15404185 PH_4: Pleckstrin homology domain 97.26
KOG0705|consensus 749 97.26
KOG4424|consensus623 97.23
KOG2059|consensus800 96.94
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 96.84
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 96.74
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 96.73
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.69
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 96.42
PLN02866 1068 phospholipase D 96.4
KOG1739|consensus 611 96.37
KOG3640|consensus1116 96.05
KOG3551|consensus 506 95.96
KOG4236|consensus 888 95.74
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 95.47
KOG1737|consensus 799 95.17
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 95.03
KOG1737|consensus 799 95.02
PF15411116 PH_10: Pleckstrin homology domain 94.81
KOG3549|consensus 505 94.52
KOG1738|consensus638 94.18
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 94.09
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 94.08
PF15404185 PH_4: Pleckstrin homology domain 93.84
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 93.62
PF15408104 PH_7: Pleckstrin homology domain 93.54
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 93.18
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 93.16
KOG4807|consensus 593 92.6
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 92.54
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 92.53
KOG3523|consensus 695 90.03
PTZ00267478 NIMA-related protein kinase; Provisional 89.2
KOG3727|consensus 664 89.16
KOG1738|consensus638 88.94
KOG2070|consensus 661 88.45
KOG0521|consensus 785 88.09
KOG3723|consensus851 87.29
KOG3531|consensus1036 85.69
KOG3543|consensus 1218 85.51
KOG4407|consensus 1973 85.2
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 82.29
KOG1170|consensus 1099 80.66
>KOG0930|consensus Back     alignment and domain information
Probab=100.00  E-value=1e-34  Score=221.37  Aligned_cols=162  Identities=61%  Similarity=1.120  Sum_probs=154.8

Q ss_pred             cccCCcceecccceeEEEechh-----------HHHHHHhhhcCCccccCCCCCCccccccCCcceeeEEeecC-ccCCe
Q psy17820         48 LIENSSGRYKSWKRRWFILNDK-----------CLYYFEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGG-RYKSW  115 (210)
Q Consensus        48 ~i~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~G~L~k~~~-~~~~w  115 (210)
                      .+++++|+|.++.+.||.+|++           +.+.|++|+..++.+|.+++.++.+.+.+|+.+|||.|.++ +.++|
T Consensus       198 sLHNpNVrDkP~lErfi~MNrgineggdlpee~LrnlyeSi~~epFkIPeddgndlthtffnpdREGWLlKlgg~rvktW  277 (395)
T KOG0930|consen  198 SLHNPNVKDKPTLERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGNRVKTW  277 (395)
T ss_pred             cccCCCCCCCccHHHHHHHhhccccCCCCcHHHHHHHHHHhcCCCCCCCcccCCcchhhccCccccceeeeecCCcccch
Confidence            3789999999999999999887           89999999999999999999999999999999999999986 77899


Q ss_pred             eEEEEEEeCCEEEEeccCCCCCceeEEEeCCeEEEEecCCCCcceEEEEeCC--ceeeeeeecCCCCceeeecceEEEEE
Q psy17820        116 KRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSG--FEFIKACKTDSEGKVVEGKHTVYRMS  193 (210)
Q Consensus       116 k~r~fvL~~~~L~yy~~~~~~~~~~~i~L~~~~v~~~~~~~~~~~f~i~~~~--~~~~~~~~~~~~~~~~~~~~r~~~l~  193 (210)
                      |||||+|.+++||||.-..+++|+|.|+|.+.+|..++++.+|+||+|+.+.  ++.+++|+.+.+|.+|.+.+..|.++
T Consensus       278 KrRWFiLtdNCLYYFe~tTDKEPrGIIpLeNlsir~VedP~kP~cfEly~ps~~gq~IKACKTe~DGRvVEG~H~vYrIs  357 (395)
T KOG0930|consen  278 KRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPKKPNCFELYIPSNKGQVIKACKTEADGRVVEGNHSVYRIS  357 (395)
T ss_pred             hheeEEeecceeeeeeeccCCCCCcceeccccceeeccCCCCCCeEEEecCCCCcCeeeeecccCCceeEeccceEEEee
Confidence            9999999999999999999999999999999999999999999999999886  49999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHhc
Q psy17820        194 AATAEEKDEWIKCLSL  209 (210)
Q Consensus       194 a~s~~e~~~Wi~al~~  209 (210)
                      |.+.+|+++||.+|++
T Consensus       358 A~~~Ee~~~Wi~sI~a  373 (395)
T KOG0930|consen  358 APTPEEKDEWIKSIKA  373 (395)
T ss_pred             CCCHHHHHHHHHHHHH
Confidence            9999999999999975



>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>KOG0932|consensus Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG1739|consensus Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>KOG3723|consensus Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3543|consensus Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>KOG1739|consensus Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1737|consensus Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1737|consensus Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG3723|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG3543|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>KOG1170|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
2r0d_A347 Crystal Structure Of Autoinhibited Form Of Grp1 Arf 6e-54
2r09_A347 Crystal Structure Of Autoinhibited Form Of Grp1 Arf 9e-53
1fgy_A127 Grp1 Ph Domain With Ins(1,3,4,5)p4 Length = 127 8e-43
1u2b_A138 Triglycine Variant Of The Grp1 Pleckstrin Homology 3e-42
1fhw_A129 Structure Of The Pleckstrin Homology Domain From Gr 5e-42
1fhx_A129 Structure Of The Pleckstrin Homology Domain From Gr 2e-41
1u27_A129 Triglycine Variant Of The Arno Pleckstrin Homology 8e-41
3tfm_A228 Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 6e-08
2yry_A122 Solution Structure Of The Ph Domain Of Pleckstrin H 2e-07
2d9y_A117 Solution Structure Of The Ph Domain Of Pepp-3 From 3e-07
1eaz_A125 Crystal Structure Of The Phosphoinositol (3,4)-Bisp 1e-06
1fao_A126 Structure Of The Pleckstrin Homology Domain From Da 2e-06
1v89_A118 Solution Structure Of The Pleckstrin Homology Domai 3e-06
1x05_A129 Solution Structure Of The C-Terminal Ph Domain Of H 3e-05
2i5c_A109 Crystal Structure Of The C-Terminal Ph Domain Of Pl 3e-05
1zm0_A114 Crystal Structure Of The Carboxyl Terminal Ph Domai 3e-05
1xx0_A127 Structure Of The C-Terminal Ph Domain Of Human Plec 3e-05
2y7b_A134 Crystal Structure Of The Ph Domain Of Human Actin-B 5e-05
1v5u_A117 Solution Structure Of The C-Terminal Pleckstrin Hom 7e-05
1pls_A113 Solution Structure Of A Pleckstrin Homology Domain 1e-04
1x1g_A129 Solution Structure Of The C-Terminal Ph Domain Of H 2e-04
2dkp_A128 Solution Structure Of The Ph Domain Of Pleckstrin H 2e-04
2dn6_A115 Solution Structure Of The Ph Domain Of Kiaa0640 Pro 2e-04
>pdb|2R0D|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 Back     alignment and structure

Iteration: 1

Score = 206 bits (525), Expect = 6e-54, Method: Compositional matrix adjust. Identities = 92/136 (67%), Positives = 111/136 (81%), Gaps = 2/136 (1%) Query: 74 FEYTTDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYT 133 +E ++PFKIPEDDGNDL HTFFNPD+EGWL K GGR K+WKRRWFIL D CLYYFEYT Sbjct: 188 YESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYT 247 Query: 134 TDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGF--EFIKACKTDSEGKVVEGKHTVYR 191 TDKEPRGIIPLEN+ +REV D KP+CFEL+ + IKACKT+++G+VVEG H VYR Sbjct: 248 TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYR 307 Query: 192 MSAATAEEKDEWIKCL 207 +SA + EEK+EW+K + Sbjct: 308 ISAPSPEEKEEWMKSI 323
>pdb|2R09|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 Back     alignment and structure
>pdb|1FGY|A Chain A, Grp1 Ph Domain With Ins(1,3,4,5)p4 Length = 127 Back     alignment and structure
>pdb|1U2B|A Chain A, Triglycine Variant Of The Grp1 Pleckstrin Homology Domain Unliganded Length = 138 Back     alignment and structure
>pdb|1FHW|A Chain A, Structure Of The Pleckstrin Homology Domain From Grp1 In Complex With Inositol(1,3,4,5,6)pentakisphosphate Length = 129 Back     alignment and structure
>pdb|1FHX|A Chain A, Structure Of The Pleckstrin Homology Domain From Grp1 In Complex With Inositol 1,3,4,5-Tetrakisphosphate Length = 129 Back     alignment and structure
>pdb|1U27|A Chain A, Triglycine Variant Of The Arno Pleckstrin Homology Domain In Complex With Ins(1,3,4,5)p4 Length = 129 Back     alignment and structure
>pdb|3TFM|A Chain A, Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 Back     alignment and structure
>pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 Back     alignment and structure
>pdb|2D9Y|A Chain A, Solution Structure Of The Ph Domain Of Pepp-3 From Human Length = 117 Back     alignment and structure
>pdb|1EAZ|A Chain A, Crystal Structure Of The Phosphoinositol (3,4)-Bisphosphate Binding Ph Domain Of Tapp1 From Human Length = 125 Back     alignment and structure
>pdb|1FAO|A Chain A, Structure Of The Pleckstrin Homology Domain From Dapp1PHISH IN COMPLEX WITH INOSITOL 1,3,4,5- Tetrakisphosphate Length = 126 Back     alignment and structure
>pdb|1V89|A Chain A, Solution Structure Of The Pleckstrin Homology Domain Of Human Kiaa0053 Protein Length = 118 Back     alignment and structure
>pdb|1X05|A Chain A, Solution Structure Of The C-Terminal Ph Domain Of Human Pleckstrin Length = 129 Back     alignment and structure
>pdb|2I5C|A Chain A, Crystal Structure Of The C-Terminal Ph Domain Of Pleckstrin In Complex With D-Myo-Ins(1,2,3,4,5)p5 Length = 109 Back     alignment and structure
>pdb|1ZM0|A Chain A, Crystal Structure Of The Carboxyl Terminal Ph Domain Of Pleckstrin To 2.1 Angstroms Length = 114 Back     alignment and structure
>pdb|1XX0|A Chain A, Structure Of The C-Terminal Ph Domain Of Human Pleckstrin Length = 127 Back     alignment and structure
>pdb|2Y7B|A Chain A, Crystal Structure Of The Ph Domain Of Human Actin-Binding Protein Anillin Anln Length = 134 Back     alignment and structure
>pdb|1V5U|A Chain A, Solution Structure Of The C-Terminal Pleckstrin Homology Domain Of Sbf1 From Mouse Length = 117 Back     alignment and structure
>pdb|1PLS|A Chain A, Solution Structure Of A Pleckstrin Homology Domain Length = 113 Back     alignment and structure
>pdb|1X1G|A Chain A, Solution Structure Of The C-Terminal Ph Domain Of Human Pleckstrin 2 Length = 129 Back     alignment and structure
>pdb|2DKP|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Protein Family A Member 5 From Human Length = 128 Back     alignment and structure
>pdb|2DN6|A Chain A, Solution Structure Of The Ph Domain Of Kiaa0640 Protein From Human Length = 115 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 3e-49
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 1e-44
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 2e-18
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 1e-35
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 1e-16
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 3e-33
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 1e-15
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 2e-32
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 5e-15
2d9y_A117 Pleckstrin homology domain-containing protein fami 2e-32
2d9y_A117 Pleckstrin homology domain-containing protein fami 6e-15
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 2e-32
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 3e-32
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 6e-14
1v88_A130 Oxysterol binding protein-related protein 8; vesic 3e-32
1v88_A130 Oxysterol binding protein-related protein 8; vesic 1e-10
1v88_A130 Oxysterol binding protein-related protein 8; vesic 3e-06
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 7e-32
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 5e-12
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 8e-32
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 7e-15
2yry_A122 Pleckstrin homology domain-containing family A mem 2e-31
2yry_A122 Pleckstrin homology domain-containing family A mem 3e-14
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 8e-31
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 5e-13
2dkp_A128 Pleckstrin homology domain-containing family A mem 2e-30
2dkp_A128 Pleckstrin homology domain-containing family A mem 1e-14
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 2e-30
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 3e-15
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 6e-30
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 2e-14
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 2e-29
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 1e-14
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 5e-29
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 2e-12
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 3e-28
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 5e-13
3cxb_B112 Pleckstrin homology domain-containing family M mem 3e-28
3cxb_B112 Pleckstrin homology domain-containing family M mem 2e-11
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 6e-28
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 5e-12
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 3e-27
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 3e-13
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 6e-27
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 1e-09
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 8e-27
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 2e-10
1u5e_A211 SRC-associated adaptor protein; novel dimerization 2e-26
1u5e_A211 SRC-associated adaptor protein; novel dimerization 3e-11
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 5e-26
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 2e-07
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 4e-04
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 5e-25
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 7e-11
2d9v_A130 Pleckstrin homology domain-containing protein fami 8e-24
2d9v_A130 Pleckstrin homology domain-containing protein fami 2e-11
3aj4_A112 Pleckstrin homology domain-containing family B ME; 2e-23
3aj4_A112 Pleckstrin homology domain-containing family B ME; 2e-11
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 2e-23
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 4e-11
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 2e-23
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 8e-23
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 1e-10
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 6e-22
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 2e-11
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 1e-21
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 2e-09
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 2e-04
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 1e-21
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 4e-11
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 2e-20
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 4e-08
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 2e-19
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 2e-10
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 2e-04
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 3e-19
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 1e-09
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 4e-19
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 4e-08
3rcp_A103 Pleckstrin homology domain-containing family A ME; 2e-18
3rcp_A103 Pleckstrin homology domain-containing family A ME; 2e-09
1wi1_A126 Calcium-dependent activator protein for secretion, 3e-18
1wi1_A126 Calcium-dependent activator protein for secretion, 1e-09
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 8e-18
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 3e-17
1v5p_A126 Pleckstrin homology domain-containing, family A; T 5e-16
1v5p_A126 Pleckstrin homology domain-containing, family A; T 1e-06
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 1e-15
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 2e-05
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 2e-14
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 6e-08
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 2e-14
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 1e-04
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 3e-13
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 3e-05
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 1e-12
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 2e-12
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 1e-04
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 2e-12
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 2e-05
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 1e-11
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 8e-11
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 3e-04
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 1e-10
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 3e-05
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 2e-10
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 1e-04
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 6e-10
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 9e-10
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 6e-04
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 1e-09
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 4e-09
2d9w_A127 Docking protein 2; PH domain, structural genomics, 1e-08
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 2e-08
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 4e-04
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 8e-08
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 1e-07
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 1e-07
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 8e-07
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-06
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 1e-06
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 2e-05
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 6e-05
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 2e-04
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 2e-04
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 2e-04
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 3e-04
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 4e-04
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 4e-04
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 9e-04
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Length = 347 Back     alignment and structure
 Score =  162 bits (412), Expect = 3e-49
 Identities = 90/132 (68%), Positives = 109/132 (82%), Gaps = 2/132 (1%)

Query: 78  TDKPFKIPEDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKE 137
            ++PFKIPEDDGNDL +TFFNPD+EGWL K GGR K+WKRRWFIL D CLYYFEYTTDKE
Sbjct: 192 KNEPFKIPEDDGNDLTYTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKE 251

Query: 138 PRGIIPLENIQVREVHDRHKPHCFELFTS--GFEFIKACKTDSEGKVVEGKHTVYRMSAA 195
           PRGIIPLEN+ +REV D  KP+CFEL+      + IKACKT+++G+VVEG H VYR+SA 
Sbjct: 252 PRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAP 311

Query: 196 TAEEKDEWIKCL 207
           + EEK+EW+K +
Sbjct: 312 SPEEKEEWMKSI 323


>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Length = 185 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Length = 151 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 100.0
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.97
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.94
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.93
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.92
1wi1_A126 Calcium-dependent activator protein for secretion, 99.91
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.91
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.9
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.89
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.89
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.89
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.88
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.88
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.88
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.88
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.88
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.88
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.88
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.87
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.87
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.87
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.87
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.87
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.87
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.87
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.87
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.86
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.86
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.86
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.86
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.86
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.86
2yry_A122 Pleckstrin homology domain-containing family A mem 99.86
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.86
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.85
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.85
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.85
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.85
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.85
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.84
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.84
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.84
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.84
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.84
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.83
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.83
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.82
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.82
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.8
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 99.8
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.8
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.8
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.79
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.78
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.77
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.77
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.77
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.74
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.74
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.72
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.72
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.67
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.66
1wi1_A126 Calcium-dependent activator protein for secretion, 99.63
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.63
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.62
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.61
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.61
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.6
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.6
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.59
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.59
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.58
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.56
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.56
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.56
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.55
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.55
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.55
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.54
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.54
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.53
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.53
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.53
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.52
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.52
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.52
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.51
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.5
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.5
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.49
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.49
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.49
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.49
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.46
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.46
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.46
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.46
2yry_A122 Pleckstrin homology domain-containing family A mem 99.44
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.44
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.44
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.43
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.43
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.42
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.42
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.41
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.39
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.39
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.38
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.38
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.37
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.37
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.36
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.36
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.35
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.34
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 99.31
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.3
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.29
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.23
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 99.22
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.2
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 99.2
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.19
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.13
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.09
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.08
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.98
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 98.98
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 98.97
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 98.96
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 98.9
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.78
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 98.68
2d9w_A127 Docking protein 2; PH domain, structural genomics, 98.67
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.66
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.54
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.54
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 98.5
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.38
3ml4_A 224 Protein DOK-7; tyrosine phosphorylation, adapter p 98.35
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 98.32
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 98.24
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.11
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 98.08
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 98.02
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.02
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.93
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.86
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.84
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.75
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 97.72
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.66
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 97.6
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.53
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.5
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 97.41
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 97.36
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.28
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.23
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.21
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 97.1
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 97.0
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 96.98
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 96.83
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 96.79
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 96.47
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 95.78
1foe_A377 T-lymphoma invasion and metastasis inducing protei 95.62
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 95.25
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 94.31
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 90.92
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 82.66
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
Probab=100.00  E-value=1.8e-37  Score=256.69  Aligned_cols=187  Identities=24%  Similarity=0.463  Sum_probs=141.8

Q ss_pred             CCCCCCeeeEEEeeCCCCCCceeEEEEE--eCCEEEEEeecCCccc-ccccCC--------------cce------eccc
Q psy17820          3 TFFNPDKEGWLWKQGGRYKSWKRRWFIL--NDKCLYYFEYTTDKSA-CLIENS--------------SGR------YKSW   59 (210)
Q Consensus         3 ~~~~~~~~G~L~K~g~~~~~wkrRwfvL--~~~~L~Yy~~~~~~~~-~~i~~~--------------~~~------~~~~   59 (210)
                      .|++..++|||+|+|+..++|+||||||  ++++|+||++++++.| ++|...              ++-      +..+
T Consensus       142 ~~~~~~keG~L~KrG~~~k~WkrRwFVL~~~~~~L~Yy~~~~~~~p~g~I~L~~~~~~~~~~~~~~~~~f~I~~~~~~~~  221 (386)
T 3lju_X          142 PYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNST  221 (386)
T ss_dssp             HHHSSEEEEEEEEECSSSCCEEEEEEEEETTTTEEEEEC-----CCSEEEEGGGEEEEECHHHHTSTTCEEEEEEETTEE
T ss_pred             cccccccccceeeeccccCCceEEEEEEEcCCCEEEEECCCCccCcccEEEeeccEEEEcccccCCCceEEEEEecCCCc
Confidence            3667889999999999999999999999  8999999999987664 332221              111      2445


Q ss_pred             ceeEEEechh--HHHHHHhhhcCCcc-----ccCCCCCCccccc-cCCcceeeEEeecCcc-CCeeEEEEEEeCCEEEEe
Q psy17820         60 KRRWFILNDK--CLYYFEYTTDKPFK-----IPEDDGNDLMHTF-FNPDKEGWLWKQGGRY-KSWKRRWFILNDKCLYYF  130 (210)
Q Consensus        60 ~~~~~~~~~~--~~~~~~~i~~~~~~-----~~~~~~~~~~~~~-~~~~~~G~L~k~~~~~-~~wk~r~fvL~~~~L~yy  130 (210)
                      +.++++++++  +..|+++|+.+...     .|.....++.+.+ .+++++|||.|+++.. +.|++|||||.++.|+||
T Consensus       222 R~y~l~A~s~~e~~~Wi~aIr~a~~~~lq~~~p~~~~~el~~~l~~~~~k~G~L~K~g~~~~k~WKkRwFVL~~~~L~YY  301 (386)
T 3lju_X          222 RNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYF  301 (386)
T ss_dssp             EEEEEECSSHHHHHHHHHHHHHHHHHHHHHHSTTCCHHHHGGGSSCCCSEEEEEEECCTTSCSCCEEEEEEEETTEEEEE
T ss_pred             eEEEEEcCCHHHHHHHHHhhhhcccccccccCCccchhhcccccccccceeeeEEEECCCCCCCCcccEEEEECCEEEEE
Confidence            6678888775  99999999765322     2444444454444 6788999999999876 899999999999999999


Q ss_pred             ccCCCCCceeEEEeCC----eEEEEecCC---CC--cceEEEEeCCceeeeeeecCCCCceeeecceEEEEEcCCHHHHH
Q psy17820        131 EYTTDKEPRGIIPLEN----IQVREVHDR---HK--PHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKD  201 (210)
Q Consensus       131 ~~~~~~~~~~~i~L~~----~~v~~~~~~---~~--~~~f~i~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~a~s~~e~~  201 (210)
                      +++.+..|.|.|+|..    +.|....+.   +.  +++|+|.++.                    |+|+|+|+|++|++
T Consensus       302 k~~~d~~~~G~I~L~~~~~~~~v~~~~~~~~~~~~~~~~F~I~t~~--------------------rty~l~A~s~~e~~  361 (386)
T 3lju_X          302 KDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPD--------------------RKFLFACETESDQR  361 (386)
T ss_dssp             SSTTCSBCSEEEECCCGGGTCEEEESCCTTCCSCCSCEEEEEECSS--------------------CEEEEEESSHHHHH
T ss_pred             ecCCCcccceEEEeecceeeeeecccCCccccccCCCcEEEEEeCC--------------------eEEEEEcCCHHHHH
Confidence            9999999999999965    344442222   11  6899998763                    79999999999999


Q ss_pred             HHHHHHhc
Q psy17820        202 EWIKCLSL  209 (210)
Q Consensus       202 ~Wi~al~~  209 (210)
                      +||.||++
T Consensus       362 ~Wi~aL~~  369 (386)
T 3lju_X          362 EWVAAFQK  369 (386)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99999985



>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 210
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 8e-32
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 3e-14
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 3e-24
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 1e-06
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 3e-18
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 4e-10
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 1e-17
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 3e-07
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 9e-17
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 9e-10
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 0.002
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 9e-16
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 6e-08
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 1e-15
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 4e-06
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 2e-15
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 1e-09
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 8e-04
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 7e-15
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 4e-06
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 2e-13
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 2e-06
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 2e-13
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 4e-07
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 3e-13
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 1e-07
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 5e-12
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 1e-07
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 0.002
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 2e-11
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 0.002
d2dfka2162 b.55.1.1 (A:240-401) Rho guanine nucleotide exchan 3e-11
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 5e-11
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 7e-05
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 6e-11
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 1e-04
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 7e-11
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 6e-07
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 2e-10
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 3e-04
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 1e-09
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 5e-07
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-09
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 4e-04
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 3e-09
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 0.002
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 4e-09
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 4e-06
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 7e-09
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 2e-06
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 7e-09
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 2e-05
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 8e-09
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 3e-07
d1fhoa_119 b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis ele 2e-08
d1fhoa_119 b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis ele 0.001
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 2e-08
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 3e-04
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 3e-08
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 4e-06
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 6e-08
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 6e-05
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 9e-08
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 1e-07
d1v61a_132 b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M 0.004
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 8e-07
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 8e-07
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 0.003
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 2e-06
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 3e-06
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 5e-04
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 6e-06
d1dbha2133 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {H 2e-05
d1xcga2140 b.55.1.1 (A:942-1081) Rho guanine nucleotide excha 6e-05
d1ntya2121 b.55.1.1 (A:1415-1535) Triple functional domain pr 1e-04
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 7e-04
d1txda2114 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exch 0.003
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Grp1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  110 bits (275), Expect = 8e-32
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 2/116 (1%)

Query: 95  TFFNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHD 154
           TFFNPD+EGWL K GGR K+WKRRWFIL D CLYYFEYTTDKEPRGIIPLEN+ +REV D
Sbjct: 1   TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLD 60

Query: 155 RHKPHCFELFTSG--FEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLS 208
             KP+CFEL+      + IKACKT+++G+VVEG H VYR+SA + EEK+EW+K + 
Sbjct: 61  PRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIK 116


>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 162 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 119 Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 119 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.9
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.9
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.88
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.87
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.86
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.86
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.86
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.84
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.84
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.83
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.83
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.83
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.82
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.82
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.81
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.81
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.8
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.8
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.8
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.8
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.79
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.79
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.75
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.75
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.75
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.73
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.73
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.7
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.67
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.65
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.62
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.59
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.52
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.51
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.5
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.5
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.49
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.48
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.47
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.45
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.43
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.42
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.39
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.39
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.38
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.35
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.34
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.32
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.32
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.29
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.26
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.23
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.2
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.19
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.18
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.18
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.15
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.15
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 99.12
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.85
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.78
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.76
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 98.19
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 98.18
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 98.16
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.03
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 97.97
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 97.92
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.71
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 97.62
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 97.18
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 95.52
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 92.99
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 92.75
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 91.4
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 90.97
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 83.95
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Grp1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.90  E-value=6.4e-23  Score=142.57  Aligned_cols=113  Identities=67%  Similarity=1.316  Sum_probs=96.3

Q ss_pred             cCCcceeeEEeecCccCCeeEEEEEEeCCEEEEeccCCCCCceeEEEeCCeEEEEecCCCCcceEEEEeCCc--eeeeee
Q psy17820         97 FNPDKEGWLWKQGGRYKSWKRRWFILNDKCLYYFEYTTDKEPRGIIPLENIQVREVHDRHKPHCFELFTSGF--EFIKAC  174 (210)
Q Consensus        97 ~~~~~~G~L~k~~~~~~~wk~r~fvL~~~~L~yy~~~~~~~~~~~i~L~~~~v~~~~~~~~~~~f~i~~~~~--~~~~~~  174 (210)
                      .+|.++|||+|+++..+.|++|||||.++.|.||+++.+..|.+.|+|.++++..+.+..++++|++.....  ......
T Consensus         3 ~np~keG~L~K~~~~~k~WkrR~fvL~~~~L~yy~~~~~~~~~g~i~L~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (127)
T d1fgya_           3 FNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKAC   82 (127)
T ss_dssp             SSCSEEEEEEEECSSSCCEEEEEEEEETTEEEEESSTTCSSCSEEEECTTCEEEEECCSSCSSEEEEECSSSTTCCCCCE
T ss_pred             CCCceEEEEEEECCCCCCcEEEEEEEECCEEEEEccCCCccccceEeCCCeEEEEccCCCCCceEEEecccccccccccc
Confidence            468999999999988889999999999999999999999999999999999998888888889999876542  222333


Q ss_pred             ecCCCCceeeecceEEEEEcCCHHHHHHHHHHHhc
Q psy17820        175 KTDSEGKVVEGKHTVYRMSAATAEEKDEWIKCLSL  209 (210)
Q Consensus       175 ~~~~~~~~~~~~~r~~~l~a~s~~e~~~Wi~al~~  209 (210)
                      .......++.+..+.++|+|+|++|+++||.||++
T Consensus        83 ~~~~~~~~~~~~~~~~~f~a~s~~e~~~Wi~aL~~  117 (127)
T d1fgya_          83 KTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKA  117 (127)
T ss_dssp             EECTTSCEEECCCSEEEEECSSHHHHHHHHHHHHH
T ss_pred             ccccceeEeeCCCeEEEEECCCHHHHHHHHHHHHH
Confidence            44445566777889999999999999999999985



>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure