Diaphorina citri psyllid: psy17821


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MDTGDDRQVEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKYSEGKVVEGKHTVYRMSAATAEEKDEWIKCLRVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRVVKCNELNNLLEPTEMGVAQFLYKGEGLNKTAIGDYLGERHDFNEKVRGR
ccccccccccccEEEEcccCEEEEcccccccCEEEEEcccccEEEEEEEcccccEEECccEEEEEccccHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHcccEEEEEEEEcccccHHHHccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccc
*********EPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKYSEGKVVEGKHTVYRMSAATAEEKDEWIKCLRVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRVVKCNELNNLLEPTEMGVAQFLYKGEGLNKTAIGDYLGERHDFNEKVRG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTGDDRQVEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKYSEGKVVEGKHTVYRMSAATAEEKDEWIKCLRVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRVVKCNELNNLLEPTEMGVAQFLYKGEGLNKTAIGDYLGERHDFNEKVRGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytohesin-2 Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane.confidentQ99418
Cytohesin-2 Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane.confidentQ2KI41
Cytohesin-2 Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane.confidentP63034

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0030155 [BP]regulation of cell adhesionprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HE9, chain A
Confidence level:very confident
Coverage over the Query: 19-152
View the alignment between query and template
View the model in PyMOL
Template: 2R09, chain A
Confidence level:very confident
Coverage over the Query: 154-192
View the alignment between query and template
View the model in PyMOL