Psyllid ID: psy17821
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 194 | 2.2.26 [Sep-21-2011] | |||||||
| Q2KI41 | 410 | Cytohesin-2 OS=Bos taurus | yes | N/A | 0.443 | 0.209 | 0.566 | 1e-21 | |
| Q76MY7 | 399 | Cytohesin-2 OS=Chlorocebu | N/A | N/A | 0.443 | 0.215 | 0.566 | 2e-21 | |
| Q99418 | 400 | Cytohesin-2 OS=Homo sapie | yes | N/A | 0.443 | 0.215 | 0.566 | 2e-21 | |
| Q15438 | 398 | Cytohesin-1 OS=Homo sapie | no | N/A | 0.443 | 0.216 | 0.555 | 2e-21 | |
| Q76MZ1 | 398 | Cytohesin-1 OS=Chlorocebu | N/A | N/A | 0.443 | 0.216 | 0.555 | 2e-21 | |
| P63035 | 400 | Cytohesin-2 OS=Rattus nor | yes | N/A | 0.443 | 0.215 | 0.566 | 2e-21 | |
| P63034 | 400 | Cytohesin-2 OS=Mus muscul | yes | N/A | 0.443 | 0.215 | 0.566 | 2e-21 | |
| P97694 | 398 | Cytohesin-1 OS=Rattus nor | no | N/A | 0.443 | 0.216 | 0.544 | 4e-21 | |
| Q9QX11 | 398 | Cytohesin-1 OS=Mus muscul | no | N/A | 0.443 | 0.216 | 0.544 | 4e-21 | |
| O08967 | 399 | Cytohesin-3 OS=Mus muscul | no | N/A | 0.443 | 0.215 | 0.511 | 6e-20 |
| >sp|Q2KI41|CYH2_BOVIN Cytohesin-2 OS=Bos taurus GN=CYTH2 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 102 bits (254), Expect = 1e-21, Method: Compositional matrix adjust.
Identities = 51/90 (56%), Positives = 62/90 (68%), Gaps = 4/90 (4%)
Query: 10 EPRGIIPLENIQVREVHDRHKPHCFELFTSGF--EFIKACKTDSEGKVVEGKHTVYRMSA 67
EPRGIIPLEN+ +REV D KP+CFEL+ + IKACKT+++G+VVEG H VYR+SA
Sbjct: 309 EPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISA 368
Query: 68 ATAEEKDEWIKYSEGKVVEGKHTVYRMSAA 97
T EEKDEWIK + V Y M AA
Sbjct: 369 PTQEEKDEWIKSIQAAV--SVDPFYEMLAA 396
|
Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane. Bos taurus (taxid: 9913) |
| >sp|Q76MY7|CYH2_CHLAE Cytohesin-2 OS=Chlorocebus aethiops GN=CYTH2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q99418|CYH2_HUMAN Cytohesin-2 OS=Homo sapiens GN=CYTH2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q15438|CYH1_HUMAN Cytohesin-1 OS=Homo sapiens GN=CYTH1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q76MZ1|CYH1_CHLAE Cytohesin-1 OS=Chlorocebus aethiops GN=CYTH1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P63035|CYH2_RAT Cytohesin-2 OS=Rattus norvegicus GN=Cyth2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P63034|CYH2_MOUSE Cytohesin-2 OS=Mus musculus GN=Cyth2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P97694|CYH1_RAT Cytohesin-1 OS=Rattus norvegicus GN=Cyth1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9QX11|CYH1_MOUSE Cytohesin-1 OS=Mus musculus GN=Cyth1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O08967|CYH3_MOUSE Cytohesin-3 OS=Mus musculus GN=Cyth3 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 194 | ||||||
| 307167289 | 441 | Cytohesin-1 [Camponotus floridanus] | 0.355 | 0.156 | 0.898 | 4e-30 | |
| 332028459 | 333 | Cytohesin-1 [Acromyrmex echinatior] | 0.443 | 0.258 | 0.75 | 7e-30 | |
| 380019731 | 434 | PREDICTED: cytohesin-1-like isoform 1 [A | 0.355 | 0.158 | 0.898 | 1e-29 | |
| 340716420 | 434 | PREDICTED: cytohesin-1-like isoform 1 [B | 0.355 | 0.158 | 0.898 | 1e-29 | |
| 383860355 | 434 | PREDICTED: cytohesin-1-like [Megachile r | 0.355 | 0.158 | 0.898 | 1e-29 | |
| 345497545 | 436 | PREDICTED: cytohesin-1-like [Nasonia vit | 0.355 | 0.158 | 0.898 | 1e-29 | |
| 350424580 | 414 | PREDICTED: cytohesin-1-like [Bombus impa | 0.355 | 0.166 | 0.898 | 2e-29 | |
| 322779022 | 459 | hypothetical protein SINV_00406 [Solenop | 0.443 | 0.187 | 0.738 | 2e-29 | |
| 340716422 | 418 | PREDICTED: cytohesin-1-like isoform 2 [B | 0.355 | 0.165 | 0.898 | 2e-29 | |
| 307206275 | 324 | Cytohesin-1 [Harpegnathos saltator] | 0.443 | 0.265 | 0.738 | 3e-29 |
| >gi|307167289|gb|EFN60957.1| Cytohesin-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 136 bits (343), Expect = 4e-30, Method: Compositional matrix adjust.
Identities = 62/69 (89%), Positives = 65/69 (94%)
Query: 10 EPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHTVYRMSAAT 69
EPRGIIPLENIQVRE+ DRHKPHCFEL+ +G EFIKACKTDSEGKVVEGKHTVYRMSAAT
Sbjct: 342 EPRGIIPLENIQVREIQDRHKPHCFELYAAGSEFIKACKTDSEGKVVEGKHTVYRMSAAT 401
Query: 70 AEEKDEWIK 78
EEKDEWIK
Sbjct: 402 DEEKDEWIK 410
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332028459|gb|EGI68502.1| Cytohesin-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380019731|ref|XP_003693756.1| PREDICTED: cytohesin-1-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340716420|ref|XP_003396696.1| PREDICTED: cytohesin-1-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383860355|ref|XP_003705656.1| PREDICTED: cytohesin-1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345497545|ref|XP_001600284.2| PREDICTED: cytohesin-1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350424580|ref|XP_003493843.1| PREDICTED: cytohesin-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|322779022|gb|EFZ09421.1| hypothetical protein SINV_00406 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|340716422|ref|XP_003396697.1| PREDICTED: cytohesin-1-like isoform 2 [Bombus terrestris] gi|380019733|ref|XP_003693757.1| PREDICTED: cytohesin-1-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307206275|gb|EFN84340.1| Cytohesin-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 194 | ||||||
| FB|FBgn0086779 | 727 | step "steppke" [Drosophila mel | 0.355 | 0.094 | 0.828 | 1.2e-26 | |
| UNIPROTKB|B7Z1T4 | 339 | CYTH1 "Cytohesin-1" [Homo sapi | 0.443 | 0.253 | 0.555 | 1.1e-21 | |
| UNIPROTKB|Q15438 | 398 | CYTH1 "Cytohesin-1" [Homo sapi | 0.443 | 0.216 | 0.555 | 1.9e-21 | |
| UNIPROTKB|F1PKP6 | 400 | CYTH1 "Uncharacterized protein | 0.443 | 0.215 | 0.555 | 2e-21 | |
| MGI|MGI:1334257 | 398 | Cyth1 "cytohesin 1" [Mus muscu | 0.443 | 0.216 | 0.544 | 4.2e-21 | |
| RGD|620397 | 398 | Cyth1 "cytohesin 1" [Rattus no | 0.443 | 0.216 | 0.544 | 4.2e-21 | |
| UNIPROTKB|P97694 | 398 | Cyth1 "Cytohesin-1" [Rattus no | 0.443 | 0.216 | 0.544 | 4.2e-21 | |
| UNIPROTKB|F1RZ72 | 398 | CYTH1 "Uncharacterized protein | 0.443 | 0.216 | 0.555 | 4.2e-21 | |
| UNIPROTKB|F1RL83 | 399 | CYTH2 "Uncharacterized protein | 0.443 | 0.215 | 0.566 | 4.3e-21 | |
| UNIPROTKB|Q76MY7 | 399 | CYTH2 "Cytohesin-2" [Chloroceb | 0.443 | 0.215 | 0.566 | 4.3e-21 |
| FB|FBgn0086779 step "steppke" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 309 (113.8 bits), Expect = 1.2e-26, P = 1.2e-26
Identities = 58/70 (82%), Positives = 62/70 (88%)
Query: 10 EPRGIIPLENIQVREVHDRHKPHCFELF-TSGFEFIKACKTDSEGKVVEGKHTVYRMSAA 68
EPRGIIPLENI VRE+HDR KPHCFELF T G + IKACKTDSEGKVVEGKHTVYRMSAA
Sbjct: 632 EPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAA 691
Query: 69 TAEEKDEWIK 78
T E++ EWIK
Sbjct: 692 TEEDQQEWIK 701
|
|
| UNIPROTKB|B7Z1T4 CYTH1 "Cytohesin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15438 CYTH1 "Cytohesin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PKP6 CYTH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1334257 Cyth1 "cytohesin 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620397 Cyth1 "cytohesin 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P97694 Cyth1 "Cytohesin-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RZ72 CYTH1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RL83 CYTH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q76MY7 CYTH2 "Cytohesin-2" [Chlorocebus aethiops (taxid:9534)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P63034 | CYH2_MOUSE | No assigned EC number | 0.5666 | 0.4432 | 0.215 | yes | N/A |
| P63035 | CYH2_RAT | No assigned EC number | 0.5666 | 0.4432 | 0.215 | yes | N/A |
| Q2KI41 | CYH2_BOVIN | No assigned EC number | 0.5666 | 0.4432 | 0.2097 | yes | N/A |
| Q99418 | CYH2_HUMAN | No assigned EC number | 0.5666 | 0.4432 | 0.215 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 5.2.1 | LOW CONFIDENCE prediction! |
| 4th Layer | 5.2.1.8 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 194 | |||
| cd01252 | 118 | cd01252, PH_GRP1-like, General Receptor for Phosph | 6e-42 | |
| cd00171 | 185 | cd00171, Sec7, Sec7 domain; Domain named after the | 1e-08 | |
| pfam01369 | 188 | pfam01369, Sec7, Sec7 domain | 6e-08 | |
| smart00222 | 189 | smart00222, Sec7, Sec7 domain | 5e-07 | |
| PLN03076 | 1780 | PLN03076, PLN03076, ARF guanine nucleotide exchang | 8e-07 | |
| cd00317 | 146 | cd00317, cyclophilin, cyclophilin: cyclophilin-typ | 1e-06 | |
| pfam00160 | 144 | pfam00160, Pro_isomerase, Cyclophilin type peptidy | 7e-06 | |
| cd01926 | 164 | cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik | 1e-05 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 1e-05 | |
| cd01927 | 148 | cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo | 3e-05 | |
| cd01921 | 166 | cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph | 1e-04 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 2e-04 | |
| cd01928 | 153 | cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 | 2e-04 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 3e-04 | |
| cd01923 | 159 | cd01923, cyclophilin_RING, cyclophilin_RING: cyclo | 9e-04 | |
| cd13260 | 103 | cd13260, PH_RASA1, RAS p21 protein activator (GTPa | 0.001 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 0.002 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 0.003 |
| >gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Score = 136 bits (345), Expect = 6e-42
Identities = 53/77 (68%), Positives = 60/77 (77%), Gaps = 2/77 (2%)
Query: 2 DTGDDRQVEPRGIIPLENIQVREVHDRHKPHCFELFTSGFEFIKACKTDSEGKVVEGKHT 61
+ D+ EPRGIIPLEN+ VREV D KP CFEL++ E IKACKTDS+GKVVEG HT
Sbjct: 35 EYTTDK--EPRGIIPLENLSVREVEDSKKPFCFELYSPSNEVIKACKTDSDGKVVEGNHT 92
Query: 62 VYRMSAATAEEKDEWIK 78
VYR+SAAT EE DEWIK
Sbjct: 93 VYRISAATEEEMDEWIK 109
|
GRP1/cytohesin3 and the related proteins ARNO (ARF nucleotide-binding site opener)/cytohesin-2 and cytohesin-1 are ARF exchange factors that contain a pleckstrin homology (PH) domain thought to target these proteins to cell membranes through binding polyphosphoinositides. The PH domains of all three proteins exhibit relatively high affinity for PtdIns(3,4,5)P3. Within the Grp1 family, diglycine (2G) and triglycine (3G) splice variants, differing only in the number of glycine residues in the PH domain, strongly influence the affinity and specificity for phosphoinositides. The 2G variants selectively bind PtdIns(3,4,5)P3 with high affinity,the 3G variants bind PtdIns(3,4,5)P3 with about 30-fold lower affinity and require the polybasic region for plasma membrane targeting. These ARF-GEFs share a common, tripartite structure consisting of an N-terminal coiled-coil domain, a central domain with homology to the yeast protein Sec7, a PH domain, and a C-terminal polybasic region. The Sec7 domain is autoinhibited by conserved elements proximal to the PH domain. GRP1 binds to the DNA binding domain of certain nuclear receptors (TRalpha, TRbeta, AR, ER, but not RXR), and can repress thyroid hormone receptor (TR)-mediated transactivation by decreasing TR-complex formation on thyroid hormone response elements. ARNO promotes sequential activation of Arf6, Cdc42 and Rac1 and insulin secretion. Cytohesin acts as a PI 3-kinase effector mediating biological responses including cell spreading and adhesion, chemotaxis, protein trafficking, and cytoskeletal rearrangements, only some of which appear to depend on their ability to activate ARFs. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 118 |
| >gnl|CDD|238100 cd00171, Sec7, Sec7 domain; Domain named after the S | Back alignment and domain information |
|---|
| >gnl|CDD|216460 pfam01369, Sec7, Sec7 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214569 smart00222, Sec7, Sec7 domain | Back alignment and domain information |
|---|
| >gnl|CDD|215560 PLN03076, PLN03076, ARF guanine nucleotide exchange factor (ARF-GEF); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | Back alignment and domain information |
|---|
| >gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating protein) 1 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 194 | |||
| KOG0546|consensus | 372 | 100.0 | ||
| KOG0880|consensus | 217 | 100.0 | ||
| KOG0879|consensus | 177 | 100.0 | ||
| cd01921 | 166 | cyclophilin_RRM cyclophilin_RRM: cyclophilin-type | 100.0 | |
| cd01923 | 159 | cyclophilin_RING cyclophilin_RING: cyclophilin-typ | 100.0 | |
| PTZ00221 | 249 | cyclophilin; Provisional | 100.0 | |
| KOG0881|consensus | 164 | 100.0 | ||
| cd01927 | 148 | cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ | 99.98 | |
| KOG0883|consensus | 518 | 99.98 | ||
| cd01928 | 153 | Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro | 99.97 | |
| PLN03149 | 186 | peptidyl-prolyl isomerase H (cyclophilin H); Provi | 99.97 | |
| cd01922 | 146 | cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c | 99.97 | |
| PTZ00060 | 183 | cyclophilin; Provisional | 99.97 | |
| COG0652 | 158 | PpiB Peptidyl-prolyl cis-trans isomerase (rotamase | 99.97 | |
| cd01926 | 164 | cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph | 99.97 | |
| KOG0882|consensus | 558 | 99.97 | ||
| KOG0111|consensus | 298 | 99.97 | ||
| cd01925 | 171 | cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: | 99.97 | |
| PRK10791 | 164 | peptidyl-prolyl cis-trans isomerase B (rotamase B) | 99.97 | |
| PRK10903 | 190 | peptidyl-prolyl cis-trans isomerase A (rotamase A) | 99.96 | |
| KOG0884|consensus | 161 | 99.96 | ||
| cd01920 | 155 | cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc | 99.96 | |
| KOG0415|consensus | 479 | 99.96 | ||
| cd00317 | 146 | cyclophilin cyclophilin: cyclophilin-type peptidyl | 99.94 | |
| PF00160 | 155 | Pro_isomerase: Cyclophilin type peptidyl-prolyl ci | 99.93 | |
| KOG0865|consensus | 167 | 99.91 | ||
| cd01924 | 176 | cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc | 99.91 | |
| KOG0885|consensus | 439 | 99.9 | ||
| KOG0930|consensus | 395 | 99.36 | ||
| KOG0930|consensus | 395 | 99.08 | ||
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 97.59 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 97.44 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 97.36 | |
| KOG0929|consensus | 1514 | 97.02 | ||
| PLN03076 | 1780 | ARF guanine nucleotide exchange factor (ARF-GEF); | 96.01 | |
| smart00222 | 187 | Sec7 Sec7 domain. Domain named after the S. cerevi | 95.44 | |
| cd00171 | 185 | Sec7 Sec7 domain; Domain named after the S. cerevi | 95.12 | |
| PF01369 | 190 | Sec7: Sec7 domain; InterPro: IPR000904 The SEC7 do | 94.56 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 93.98 | |
| KOG0882|consensus | 558 | 93.79 | ||
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 93.03 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 92.44 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 89.88 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 89.27 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 87.11 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 84.27 | |
| COG5307 | 1024 | SEC7 domain proteins [General function prediction | 81.49 | |
| KOG0931|consensus | 627 | 80.82 |
| >KOG0546|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-42 Score=297.04 Aligned_cols=137 Identities=27% Similarity=0.349 Sum_probs=126.9
Q ss_pred cCCceeEeccccCccEEEEEcCCcc-----chhhhcccCCCCeeecCcceeeecCccCccccCceeeec---------Cc
Q psy17821 17 LENIQVREVHDRHKPHCFELFTSGF-----EFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKYS---------EG 82 (194)
Q Consensus 17 l~~~~v~~~~~~~g~i~feL~~~~~-----NFi~Lc~~~~~g~~v~g~~~~Y~~s~f~rv~~~~~iqg~---------g~ 82 (194)
+--+++-+-.++.|||+||||.+.| ||++||+|+..+....|+.|+|+++.||||+++|||||| |.
T Consensus 10 r~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnGtGGe 89 (372)
T KOG0546|consen 10 RVFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGEKGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNGTGGE 89 (372)
T ss_pred eEEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccccCCCCCCCCeeeecCchhheeeecceeeccccccCCCCCcc
Confidence 3445566677889999999999988 999999999655678899999999999999999999995 78
Q ss_pred cccc-----------CCCceeecccccCC---Cccccee------eccceEEEeEEEccHHHHHHhhcCCcCCCCCCCcc
Q psy17821 83 KVVE-----------GKHTVYRMSAATAE---EKDEWIK------CLRVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQD 142 (194)
Q Consensus 83 si~g-----------~~~~g~l~man~g~---~sqf~i~------l~g~~vvFG~V~~G~dvv~~I~~~~~~~~~~P~~~ 142 (194)
|||| |++|++|||||+|| ||||||| |||+||||||||+|++||+.||++.+|..++|..+
T Consensus 90 SIYG~~FdDEnF~lKHdrpflLSMAN~GpNTNgSQFFITT~p~PHLdGkHVVFGqVI~G~~VVr~IEn~~~d~~skP~~d 169 (372)
T KOG0546|consen 90 SIYGEKFDDENFELKHDRPFLLSMANRGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGKEVVREIENLETDEESKPLAD 169 (372)
T ss_pred cccccccccccceeccCcchhhhhhcCCCCCCCcceEEeCCCCCCcCCceeEEeeEeechhHHHHHhccccccCCCCccc
Confidence 9998 99999999999999 9999999 79999999999999999999999999999999999
Q ss_pred eEEEEEeeecC
Q psy17821 143 VRVVKCNELNN 153 (194)
Q Consensus 143 i~I~~~g~~~~ 153 (194)
|+|.+||++..
T Consensus 170 V~I~dCGel~~ 180 (372)
T KOG0546|consen 170 VVISDCGELVK 180 (372)
T ss_pred eEecccccccc
Confidence 99999999986
|
|
| >KOG0880|consensus | Back alignment and domain information |
|---|
| >KOG0879|consensus | Back alignment and domain information |
|---|
| >cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >PTZ00221 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >KOG0881|consensus | Back alignment and domain information |
|---|
| >cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >KOG0883|consensus | Back alignment and domain information |
|---|
| >cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >PTZ00060 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >KOG0882|consensus | Back alignment and domain information |
|---|
| >KOG0111|consensus | Back alignment and domain information |
|---|
| >cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >KOG0884|consensus | Back alignment and domain information |
|---|
| >cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >KOG0415|consensus | Back alignment and domain information |
|---|
| >cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms | Back alignment and domain information |
|---|
| >KOG0865|consensus | Back alignment and domain information |
|---|
| >cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >KOG0885|consensus | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0929|consensus | Back alignment and domain information |
|---|
| >PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional | Back alignment and domain information |
|---|
| >smart00222 Sec7 Sec7 domain | Back alignment and domain information |
|---|
| >cd00171 Sec7 Sec7 domain; Domain named after the S | Back alignment and domain information |
|---|
| >PF01369 Sec7: Sec7 domain; InterPro: IPR000904 The SEC7 domain was named after the first protein found to contain such a region [] | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0882|consensus | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >COG5307 SEC7 domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0931|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 194 | ||||
| 1u27_A | 129 | Triglycine Variant Of The Arno Pleckstrin Homology | 6e-22 | ||
| 2r0d_A | 347 | Crystal Structure Of Autoinhibited Form Of Grp1 Arf | 7e-21 | ||
| 2r0d_A | 347 | Crystal Structure Of Autoinhibited Form Of Grp1 Arf | 9e-11 | ||
| 1fhw_A | 129 | Structure Of The Pleckstrin Homology Domain From Gr | 1e-20 | ||
| 2r09_A | 347 | Crystal Structure Of Autoinhibited Form Of Grp1 Arf | 2e-20 | ||
| 2r09_A | 347 | Crystal Structure Of Autoinhibited Form Of Grp1 Arf | 9e-11 | ||
| 1u2b_A | 138 | Triglycine Variant Of The Grp1 Pleckstrin Homology | 2e-20 | ||
| 1fhx_A | 129 | Structure Of The Pleckstrin Homology Domain From Gr | 3e-20 | ||
| 1fgy_A | 127 | Grp1 Ph Domain With Ins(1,3,4,5)p4 Length = 127 | 7e-20 | ||
| 1bc9_A | 200 | Cytohesin-1B2-1 Sec7 Domain, Nmr, Minimized Average | 6e-10 | ||
| 4a4p_A | 192 | Crystal Structure Of The Sec7 Domain From Human Cyt | 6e-10 | ||
| 1pbv_A | 195 | Sec7 Domain Of The Exchange Factor Arno Length = 19 | 1e-08 | ||
| 1r8m_E | 203 | Sec7 Domain Of The Arf Exchange Factor Arno With Br | 1e-08 | ||
| 1r8q_E | 203 | Full-Length Arf1-Gdp-Mg In Complex With Brefeldin A | 1e-08 | ||
| 1r8s_E | 203 | Arf1[delta1-17]-Gdp In Complex With A Sec7 Domain C | 1e-08 | ||
| 2he9_A | 192 | Structure Of The Peptidylprolyl Isomerase Domain Of | 4e-07 | ||
| 2wfi_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 5e-07 | ||
| 2wfj_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 5e-07 | ||
| 2gw2_A | 198 | Crystal Structure Of The Peptidyl-Prolyl Isomerase | 6e-07 | ||
| 1c5f_A | 177 | Crystal Structure Of The Cyclophilin-Like Domain Fr | 9e-07 |
| >pdb|1U27|A Chain A, Triglycine Variant Of The Arno Pleckstrin Homology Domain In Complex With Ins(1,3,4,5)p4 Length = 129 | Back alignment and structure |
|
| >pdb|2R0D|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 | Back alignment and structure |
| >pdb|2R0D|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 | Back alignment and structure |
| >pdb|1FHW|A Chain A, Structure Of The Pleckstrin Homology Domain From Grp1 In Complex With Inositol(1,3,4,5,6)pentakisphosphate Length = 129 | Back alignment and structure |
| >pdb|2R09|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 | Back alignment and structure |
| >pdb|2R09|A Chain A, Crystal Structure Of Autoinhibited Form Of Grp1 Arf Gtpase Exchange Factor Length = 347 | Back alignment and structure |
| >pdb|1U2B|A Chain A, Triglycine Variant Of The Grp1 Pleckstrin Homology Domain Unliganded Length = 138 | Back alignment and structure |
| >pdb|1FHX|A Chain A, Structure Of The Pleckstrin Homology Domain From Grp1 In Complex With Inositol 1,3,4,5-Tetrakisphosphate Length = 129 | Back alignment and structure |
| >pdb|1FGY|A Chain A, Grp1 Ph Domain With Ins(1,3,4,5)p4 Length = 127 | Back alignment and structure |
| >pdb|1BC9|A Chain A, Cytohesin-1B2-1 Sec7 Domain, Nmr, Minimized Average Structure Length = 200 | Back alignment and structure |
| >pdb|4A4P|A Chain A, Crystal Structure Of The Sec7 Domain From Human Cytohesin1 Length = 192 | Back alignment and structure |
| >pdb|1PBV|A Chain A, Sec7 Domain Of The Exchange Factor Arno Length = 195 | Back alignment and structure |
| >pdb|1R8M|E Chain E, Sec7 Domain Of The Arf Exchange Factor Arno With Brefeldin A- Sensitizing Mutations Length = 203 | Back alignment and structure |
| >pdb|1R8Q|E Chain E, Full-Length Arf1-Gdp-Mg In Complex With Brefeldin A And A Sec7 Domain Length = 203 | Back alignment and structure |
| >pdb|1R8S|E Chain E, Arf1[delta1-17]-Gdp In Complex With A Sec7 Domain Carrying The Mutation Of The Catalytic Glutamate To Lysine Length = 203 | Back alignment and structure |
| >pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 | Back alignment and structure |
| >pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 | Back alignment and structure |
| >pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 | Back alignment and structure |
| >pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 | Back alignment and structure |
| >pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Length = 347 | Back alignment and structure |
|---|
Score = 90.9 bits (225), Expect = 4e-22
Identities = 43/75 (57%), Positives = 56/75 (74%), Gaps = 2/75 (2%)
Query: 6 DRQVEPRGIIPLENIQVREVHDRHKPHCFELFTS--GFEFIKACKTDSEGKVVEGKHTVY 63
EPRGIIPLEN+ +REV D KP+CFEL+ + IKACKT+++G+VVEG H VY
Sbjct: 247 TTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVY 306
Query: 64 RMSAATAEEKDEWIK 78
R+SA + EEK+EW+K
Sbjct: 307 RISAPSPEEKEEWMK 321
|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Length = 347 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 | Back alignment and structure |
|---|
| >1r8s_E ARNO; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Homo sapiens} SCOP: a.118.3.1 PDB: 1r8m_E* 1r8q_E* 1s9d_E* 1pbv_A 1bc9_A Length = 203 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 | Back alignment and structure |
|---|
| >3ltl_A Brefeldin A-inhibited guanine nucleotide-exchange 1; all alpha, guanine-nucleotide releasing factor, signaling PR; 2.20A {Homo sapiens} PDB: 3l8n_A 3swv_A Length = 211 | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >1xsz_A Guanine nucleotide exchange protein; ARF guanine nucleotide exchange factor, signaling protein; 1.41A {Legionella pneumophila} SCOP: a.118.3.1 d.129.9.1 PDB: 1xt0_B Length = 356 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 194 | |||
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 100.0 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 100.0 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 100.0 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 100.0 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 100.0 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 100.0 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 100.0 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 100.0 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 100.0 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 100.0 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 100.0 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 100.0 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 100.0 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 100.0 | |
| 4fru_A | 185 | Cyclophilin B, peptidyl-prolyl CIS-trans isomerase | 100.0 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 100.0 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 100.0 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 100.0 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 100.0 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 100.0 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 100.0 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 100.0 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 100.0 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 100.0 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 100.0 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 100.0 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 100.0 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 100.0 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 99.98 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 99.97 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 99.97 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.97 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 99.92 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 98.22 | |
| 1r8s_E | 203 | ARNO; protein transport/exchange factor, protein t | 97.31 | |
| 3ltl_A | 211 | Brefeldin A-inhibited guanine nucleotide-exchange | 97.3 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 96.76 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 96.67 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 96.28 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 96.23 | |
| 1xsz_A | 356 | Guanine nucleotide exchange protein; ARF guanine n | 95.46 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 95.17 | |
| 1ku1_A | 230 | ARF guanine-nucleotide exchange factor 2; SEC7 dom | 93.73 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 91.84 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 91.7 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 89.75 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 88.79 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 88.15 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 88.12 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 87.76 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 86.41 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 86.33 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 84.86 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 84.72 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 83.98 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 83.96 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 80.72 |
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-36 Score=244.08 Aligned_cols=132 Identities=26% Similarity=0.347 Sum_probs=114.5
Q ss_pred ceeEeccccCccEEEEEcCCcc-----chhhhcccCCCCeeecCcceeeecCccCccccCceeeec---------Ccccc
Q psy17821 20 IQVREVHDRHKPHCFELFTSGF-----EFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKYS---------EGKVV 85 (194)
Q Consensus 20 ~~v~~~~~~~g~i~feL~~~~~-----NFi~Lc~~~~~g~~v~g~~~~Y~~s~f~rv~~~~~iqg~---------g~si~ 85 (194)
+.+.+..++.|+|+||||++.+ ||++||+++..-....++..+|+++.|||++|+|||||+ +.|+|
T Consensus 14 ~di~i~~t~~G~i~ieL~~~~aP~t~~NF~~L~~g~~g~~~~~~~~~~Y~g~~FhRvi~~f~iQgGd~~~~~g~gg~si~ 93 (179)
T 2wfi_A 14 FDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIY 93 (179)
T ss_dssp EEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHCTTCBCTTTCSBSCCTTCBEEEEETTTEEEECCTTTSSSSCCCCTT
T ss_pred EEEEECCccceEEEEEEcCCCCChHHHHHHHHhcCCcCcccccccCCeECCCEEEEEECCCEEEcccccCCCCCCCCccc
Confidence 4566678899999999999987 999999876211111234568999999999999999996 35787
Q ss_pred c-----------CCCceeecccccCC---Cccccee------eccceEEEeEEEccHHHHHHhhcCCcCCCCCCCcceEE
Q psy17821 86 E-----------GKHTVYRMSAATAE---EKDEWIK------CLRVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRV 145 (194)
Q Consensus 86 g-----------~~~~g~l~man~g~---~sqf~i~------l~g~~vvFG~V~~G~dvv~~I~~~~~~~~~~P~~~i~I 145 (194)
+ |+++|+|||||.++ +|||||+ ||++|||||+|++|||||++|++++++.+++|.++|+|
T Consensus 94 g~~f~dE~~~~~h~~~G~lsMAn~gp~tngSQFfIt~~~~~~LDg~~tVFG~Vv~G~dvv~~I~~~~t~~~~~P~~~v~I 173 (179)
T 2wfi_A 94 GGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRI 173 (179)
T ss_dssp SSCBCCCCCCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTCCBCTTSCBSSCEEE
T ss_pred CCcccccccCcCcCCCeEEEEEeCCCCCcceEEEEEcCCCcccCCCeeEEEEEeCCHHHHHHHHcCCCCCCCCCCCCeEE
Confidence 6 78899999999998 8999999 68999999999999999999999999988999999999
Q ss_pred EEEeee
Q psy17821 146 VKCNEL 151 (194)
Q Consensus 146 ~~~g~~ 151 (194)
.+||++
T Consensus 174 ~~~G~l 179 (179)
T 2wfi_A 174 LSCGEL 179 (179)
T ss_dssp EEEEEC
T ss_pred EeCeeC
Confidence 999975
|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A | Back alignment and structure |
|---|
| >4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >1r8s_E ARNO; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Homo sapiens} SCOP: a.118.3.1 PDB: 1r8m_E* 1r8q_E* 1s9d_E* 1pbv_A 1bc9_A | Back alignment and structure |
|---|
| >3ltl_A Brefeldin A-inhibited guanine nucleotide-exchange 1; all alpha, guanine-nucleotide releasing factor, signaling PR; 2.20A {Homo sapiens} SCOP: a.118.3.0 PDB: 3l8n_A 3swv_A | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1xsz_A Guanine nucleotide exchange protein; ARF guanine nucleotide exchange factor, signaling protein; 1.41A {Legionella pneumophila} SCOP: a.118.3.1 d.129.9.1 PDB: 1xt0_B | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1ku1_A ARF guanine-nucleotide exchange factor 2; SEC7 domain, guanine nucleotide exchange factor (GEF), ARF small GTP-binding proteins; 1.93A {Saccharomyces cerevisiae} SCOP: a.118.3.1 PDB: 1re0_B* | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 194 | ||||
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 7e-13 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 5e-12 | |
| d1qoia_ | 173 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom | 2e-08 | |
| d1a33a_ | 174 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( | 1e-07 | |
| d2rmca_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus | 2e-07 | |
| d1xo7a_ | 166 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom | 2e-07 | |
| d1h0pa_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd | 6e-07 | |
| d1r8se_ | 187 | a.118.3.1 (E:) Exchange factor ARNO {Human (Homo s | 6e-07 | |
| d2fu0a1 | 155 | b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { | 1e-06 | |
| d1z81a1 | 186 | b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas | 1e-06 | |
| d1xwna1 | 166 | b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome | 1e-06 | |
| d2z6wa1 | 164 | b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c | 2e-06 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 2e-06 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 8e-04 | |
| d1ihga2 | 195 | b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain | 2e-06 | |
| d2igva1 | 172 | b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno | 3e-06 | |
| d1xsza1 | 197 | a.118.3.1 (A:1-197) RalF, N-terminal domain {Legio | 1e-05 | |
| d2b71a1 | 169 | b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 | 1e-05 | |
| d1qnga_ | 170 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium | 2e-05 | |
| d2r99a1 | 161 | b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl | 3e-05 | |
| d1v9ta_ | 166 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 7e-05 | |
| d2cfea1 | 162 | b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s | 1e-04 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 1e-04 | |
| d1zkca1 | 178 | b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso | 3e-04 | |
| d2ok3a1 | 159 | b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B | 4e-04 | |
| d1ku1a_ | 211 | a.118.3.1 (A:) ARF guanine-exchange factor 2, Gea2 | 4e-04 | |
| d1w74a_ | 171 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 8e-04 | |
| d2a2na1 | 164 | b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma | 0.001 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 0.002 |
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Grp1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 60.7 bits (146), Expect = 7e-13
Identities = 43/76 (56%), Positives = 56/76 (73%), Gaps = 2/76 (2%)
Query: 5 DDRQVEPRGIIPLENIQVREVHDRHKPHCFELFTSG--FEFIKACKTDSEGKVVEGKHTV 62
EPRGIIPLEN+ +REV D KP+CFEL+ + IKACKT+++G+VVEG H V
Sbjct: 38 YTTDKEPRGIIPLENLSIREVLDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVV 97
Query: 63 YRMSAATAEEKDEWIK 78
YR+SA + EEK+EW+K
Sbjct: 98 YRISAPSPEEKEEWMK 113
|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 | Back information, alignment and structure |
|---|
| >d1r8se_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 | Back information, alignment and structure |
|---|
| >d1xsza1 a.118.3.1 (A:1-197) RalF, N-terminal domain {Legionella pneumophila [TaxId: 446]} Length = 197 | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1ku1a_ a.118.3.1 (A:) ARF guanine-exchange factor 2, Gea2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 211 | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 194 | |||
| d2ok3a1 | 159 | Cyclophilin-like protein PPIL3B {Human (Homo sapie | 99.97 | |
| d2igva1 | 172 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 99.97 | |
| d2rmca_ | 182 | Cyclophilin (eukaryotic) {Mouse (Mus musculus), va | 99.97 | |
| d1a33a_ | 174 | Cyclophilin (eukaryotic) {Nematode (Brugia malayi) | 99.97 | |
| d1zkca1 | 178 | Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop | 99.97 | |
| d2z6wa1 | 164 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 99.97 | |
| d1h0pa_ | 182 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 99.97 | |
| d2r99a1 | 161 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 99.97 | |
| d1ihga2 | 195 | Cyclophilin 40 isomerase domain {Cow (Bos taurus) | 99.97 | |
| d1xo7a_ | 166 | Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId | 99.97 | |
| d1qoia_ | 173 | Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 | 99.97 | |
| d2fu0a1 | 155 | Putative cyclophilin PFE0505w {Plasmodium falcipar | 99.97 | |
| d1qnga_ | 170 | Cyclophilin (eukaryotic) {Plasmodium falciparum [T | 99.97 | |
| d1xwna1 | 166 | Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 | 99.97 | |
| d2b71a1 | 169 | Cyclophilin-like protein PY00693 {Plasmodium yoeli | 99.96 | |
| d2cfea1 | 162 | Cyclophilin-like allergen Mal s 6 {Malassezia symp | 99.96 | |
| d1z81a1 | 186 | Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId | 99.96 | |
| d1w74a_ | 171 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob | 99.95 | |
| d2a2na1 | 164 | Peptidylprolyl isomerase domain and WD repeat-cont | 99.95 | |
| d1v9ta_ | 166 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 99.95 | |
| d2c3ba1 | 171 | Cyclophilin (eukaryotic) {Aspergillus fumigatus [T | 99.95 | |
| d1lopa_ | 164 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 99.95 | |
| d1r8se_ | 187 | Exchange factor ARNO {Human (Homo sapiens) [TaxId: | 96.59 | |
| d1xsza1 | 197 | RalF, N-terminal domain {Legionella pneumophila [T | 95.69 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 94.23 | |
| d1ku1a_ | 211 | ARF guanine-exchange factor 2, Gea2 {Baker's yeast | 94.19 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 93.86 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 91.03 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 90.94 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 86.29 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 80.6 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 80.07 |
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Cyclophilin-like protein PPIL3B species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=1.4e-32 Score=214.23 Aligned_cols=119 Identities=20% Similarity=0.273 Sum_probs=107.1
Q ss_pred eccccCccEEEEEcCCcc-----chhhhcccCCCCeeecCcceeeecCccCccccCceeeec--------Cccccc----
Q psy17821 24 EVHDRHKPHCFELFTSGF-----EFIKACKTDSEGKVVEGKHTVYRMSAATAEEKDEWIKYS--------EGKVVE---- 86 (194)
Q Consensus 24 ~~~~~~g~i~feL~~~~~-----NFi~Lc~~~~~g~~v~g~~~~Y~~s~f~rv~~~~~iqg~--------g~si~g---- 86 (194)
.++|+.|+|+||||.+.+ ||++||+++ +|+++.|||+++++|||++ +...|+
T Consensus 4 ~~~T~~G~i~ieL~~~~aP~tv~nF~~L~~~g-----------~Y~~~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~ 72 (159)
T d2ok3a1 4 TLHTDVGDIKIEVFCERTPKTCENFLALCASN-----------YYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFE 72 (159)
T ss_dssp EEEETTEEEEEEECTTTCHHHHHHHHHHHHTT-----------TTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBC
T ss_pred EEEeCCeEEEEEEcCCCChHHHHHHHHHHhhh-----------cccceeEecccCCeEEEeCCccccCCCCcccCCCccc
Confidence 568889999999999987 999999999 9999999999999999996 122222
Q ss_pred --------CCCceeecccccCC---Cccccee------eccceEEEeEEEccHHHHHHhhcCCcCC-CCCCCcceEEEEE
Q psy17821 87 --------GKHTVYRMSAATAE---EKDEWIK------CLRVHVVFGHVVSGQNVVSHIENLPVDK-MSRPLQDVRVVKC 148 (194)
Q Consensus 87 --------~~~~g~l~man~g~---~sqf~i~------l~g~~vvFG~V~~G~dvv~~I~~~~~~~-~~~P~~~i~I~~~ 148 (194)
|..+|+++||+.++ +|||||+ ||++|+|||||++||++|++|+++++++ +++|..+|+|.+|
T Consensus 73 ~e~~~~~~~~~~G~lsma~~~~~s~~sqFfIt~~~~p~ld~~~tvFG~V~~G~~vl~~I~~~~~~~~~~~P~~~i~I~~v 152 (159)
T d2ok3a1 73 DEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDI 152 (159)
T ss_dssp CCCCTTCCSCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTCCBCTTTCCBSSCCBEEEE
T ss_pred cccccCCCCCCCeEEEEeeCCCCCcCcceEeeeccCcccccceEEEEecccchHHHHHHHcCcCCCCCCCcCCCcEEEEE
Confidence 78899999999887 7899999 5789999999999999999999999975 5789999999999
Q ss_pred eeecC
Q psy17821 149 NELNN 153 (194)
Q Consensus 149 g~~~~ 153 (194)
.++.+
T Consensus 153 ~i~~~ 157 (159)
T d2ok3a1 153 TIHAN 157 (159)
T ss_dssp EEECC
T ss_pred EEEeC
Confidence 99987
|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8se_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xsza1 a.118.3.1 (A:1-197) RalF, N-terminal domain {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ku1a_ a.118.3.1 (A:) ARF guanine-exchange factor 2, Gea2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|