Diaphorina citri psyllid: psy17834


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MSIYPRKVILDVDAGIDDAWALLLMLKAEQKNLIEIIAITCCHGNAELSEVVDNVCRVLQAFGRKNIPVYKGVSKPLIPKDLSHKYSFDWLHFFGKNGFGDIDLGDSDTLDRSCHVENISAVVALHELTREFKGLISVLCLAPLTNIALTLRLFPQFAQNAKELYIMGGNHKGVGNVTSAAEFNFLTDPEAAHIVLGGFHGPICILPWEACLGIDISYEWRYDTLGASDAPYISLLNRLERGISDRAISMGFNKWVPADSALCTCFLDEKAITVSYETTCSVELAGEITRGQACVDVVHSKTPNVRMIDTVDSRLLKDMLLWIKD
ccccccEEEEEccccHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccHHccccEEEEccccccccccccHHcccccccHHHHHHHHccccccEEEEcccHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccEEEEEEEEEEEEEccccccccEEEEccccccccCEEEccccHHHHHHHHHHccc
***YPRKVILDVDAGIDDAWALLLMLKAEQKNLIEIIAITCCHGNAELSEVVDNVCRVLQAFGRKNIPVYKGVSKPLIPKDLSHKYSFDWLHFFGKNGFGDIDLGDSDTLDRSCHVENISAVVALHELTREFKGLISVLCLAPLTNIALTLRLFPQFAQNAKELYIMGGNHKGVGNVTSAAEFNFLTDPEAAHIVLGGFHGPICILPWEACLGIDISYEWRYDTLGASDAPYISLLNRLERGISDRAISMGFNKWVPADSALCTCFLDEKAITVSYETTCSVELAGEITRGQACVDVVHSKTPNVRMIDTVDSRLLKDMLLWIKD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIYPRKVILDVDAGIDDAWALLLMLKAEQKNLIEIIAITCCHGNAELSEVVDNVCRVLQAFGRKNIPVYKGVSKPLIPKDLSHKYSFDWLHFFGKNGFGDIDLGDSDTLDRSCHVENISAVVALHELTREFKGLISVLCLAPLTNIALTLRLFPQFAQNAKELYIMGGNHKGVGNVTSAAEFNFLTDPEAAHIVLGGFHGPICILPWEACLGIDISYEWRYDTLGASDAPYISLLNRLERGISDRAISMGFNKWVPADSALCTCFLDEKAITVSYETTCSVELAGEITRGQACVDVVHSKTPNVRMIDTVDSRLLKDMLLWIKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyrimidine-specific ribonucleoside hydrolase RihA Hydrolyzes with equal efficiency cytidine or uridine to ribose and cytosine or uracil, respectively.confidentB1IYF7
Pyrimidine-specific ribonucleoside hydrolase RihA Hydrolyzes with equal efficiency cytidine or uridine to ribose and cytosine or uracil, respectively.confidentB7L9J7
Pyrimidine-specific ribonucleoside hydrolase RihA Hydrolyzes cytidine or uridine to ribose and cytosine or uracil, respectively.confidentA4W829

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046135 [BP]pyrimidine nucleoside catabolic processprobableGO:0044248, GO:0072529, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0071704, GO:0072527, GO:0044281, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0008150, GO:0009116, GO:0008152, GO:0034655, GO:0009056, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0009164, GO:0006213, GO:1901657, GO:0019439, GO:1901658, GO:1901565
GO:0042454 [BP]ribonucleoside catabolic processprobableGO:0044248, GO:0034641, GO:0006807, GO:0044281, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0071704, GO:0044270, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0008150, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0009056, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901565, GO:1901136, GO:1901135, GO:0009164, GO:0044237, GO:1901657, GO:0019439, GO:1901658
GO:0047724 [MF]inosine nucleosidase activityprobableGO:0016787, GO:0016799, GO:0016798, GO:0003824, GO:0003674, GO:0008477
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0047622 [MF]adenosine nucleosidase activityprobableGO:0016787, GO:0016799, GO:0016798, GO:0003824, GO:0003674, GO:0008477
GO:0045437 [MF]uridine nucleosidase activityprobableGO:0016787, GO:0016799, GO:0016798, GO:0003824, GO:0050263, GO:0003674
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0047405 [MF]pyrimidine-5'-nucleotide nucleosidase activityprobableGO:0016787, GO:0003674, GO:0016799, GO:0016798, GO:0003824

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FZ0, chain A
Confidence level:very confident
Coverage over the Query: 4-324
View the alignment between query and template
View the model in PyMOL