Diaphorina citri psyllid: psy17863


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MEYTCVQTIDCKQGAIRAVRFNVDGSYCLTCGSDKKIKLWNPYRNLLLKTYGGHAHEVNDATAACDSSQIASGASDKSVILWEVTTGQPVRRWREHASKVTCVKFNEDSSVVISGSQDNTVMMWDVKSRSHHPIQCCLDSKDSQIFCGSSDGKIYKWQLVDSSQISTLIHSVGKAVVNSLCSHPTRKHIMSACGNNVKLWTAEEDYGQEPIVDACFTRDCQCILTCSTDECLRLFDKATGELLEEYKGHKSGDFRIECCLDSKDSQIFCGSSDGKIYKWQLVDSSQISTLIHSVGKAVVNSLCSHPTRKHIMSACGNNVKLWTAEEDYGQAGLSSLYLNMS
cccCEEEEECcccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEccccCEEEEcccccccEEEEEEcccccEEEEECccccEEEEEccccccccEEEEEEccccEEEEECccccEEEEEcccccEEEEcccccccccEEEEEEcccccEEEEEccccEEEEEcccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEccccccEEEEEEEEcccccEEEEccccccEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEccccccccc
MEYTCVQTIDCKQGAIRAVRFNVDGSYCLTCGSDKKIKLWNPYRNLLLKTYGGHAHEVNDATAACDSSQIASGASDKSVILWEVTTGQPVRRWREHASKVTCVKFNEDSSVVISGSQDNTVMMWDVKSRSHHPIQCCLDSKDSQIFCGSSDGKIYKWQLVDSSQISTLIHSVGKAVVNSLCSHPTRKHIMSACGNNVKLWTAEEDYGQEPIVDACFTRDCQCILTCSTDECLRLFDKATGELLEEYKGHKSGDFRIECCLDSKDSQIFCGSSDGKIYKWQLVDSSQISTLIHSVGKAVVNSLCSHPTRKHIMSACGNNVKLWTAEEDYGQAGLSS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYTCVQTIDCKQGAIRAVRFNVDGSYCLTCGSDKKIKLWNPYRNLLLKTYGGHAHEVNDATAACDSSQIASGASDKSVILWEVTTGQPVRRWREHASKVTCVKFNEDSSVVISGSQDNTVMMWDVKSRSHHPIQCCLDSKDSQIFCGSSDGKIYKWQLVDSSQISTLIHSVGKAVVNSLCSHPTRKHIMSACGNNVKLWTAEEDYGQEPIVDACFTRDCQCILTCSTDECLRLFDKATGELLEEYKGHKSGDFRIECCLDSKDSQIFCGSSDGKIYKWQLVDSSQISTLIHSVGKAVVNSLCSHPTRKHIMSACGNNVKLWTAEEDYGQAGLSSLYLNMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat domain-containing protein 83 Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator (By similarity). May also be involved in pre-mRNA splicing.confidentQ9BRX9
WD repeat domain-containing protein 83 Molecular scaffold protein for various multimeric protein complexes. Involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator (By similarity). Also acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. May also be involved in pre-mRNA splicing.confidentQ9DAJ4
WD repeat domain-containing protein 83 Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha.confidentQ5XGI5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000375 [BP]RNA splicing, via transesterification reactionsprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0008380, GO:0006396, GO:0046483
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 3-326
View the alignment between query and template
View the model in PyMOL