Diaphorina citri psyllid: psy17864

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-

MNSVFNEHPSRRISDDFIEKAVAEARASFKVSFKFQVNSGLNLDVTSTIGKKLATYWNGSLKAMRERQCSRQEVVAHYSNRALDDDMRSQMALDWIAREQENPGALGRELDQAERELETARLAGRELRFPKEKKDILMLAHTQINGGSLSS

ccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccc

*******H*SRRISDDFIEKAVAEARASFKVSFKFQVNSGLNLDVTSTIGKKLATYWNGSLKAMRERQCSRQEVVAHYSNRALDDDMRSQMALDWIA*****************RELE**RLAGRELRFPKEKKDILMLAHTQ********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNSVFNEHPSRRISDDFIEKAVAEARASFKVSFKFQVNSGLNLDVTSTIGKKLATYWNGSLKAMRERQCSRQEVVAHYSNRALDDDMRSQMALDWIAREQENPGALGRELDQAERELETARLAGRELRFPKEKKDILMLAHTQINGGSLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LIX1-like protein		confident	Q8IVB5
LIX1-like protein		confident	Q5PQQ7
LIX1-like protein		confident	Q8BQ89

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0035003 [CC]	subapical complex	probable	GO:0032991, GO:0043296, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005911, GO:0005886, GO:0044425, GO:0044459, GO:0030054
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted