Diaphorina citri psyllid: psy17866


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MVNVVEALQEFWQMKQTRGAELKNGALVIYESVPSASPPYVCYVTLPGGSCFGSFQTLEVEVSRSQMALDWIAREQENPGALGRELDQAERELETARLAGRELRFPKEKKDILMLAHTQINGGSLSS
ccHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccc
*VNVVEALQEFWQMKQTRGAELKNGALVIYESVPSASPPYVCYVTLPGGSCFGSFQTLEVEVSRSQMALDWIAR*Q************AERELETARLAGRELRFPKEKKDILMLAHT*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNVVEALQEFWQMKQTRGAELKNGALVIYESVPSASPPYVCYVTLPGGSCFGSFQTLEVEVSRSQMALDWIAREQENPGALGRELDQAERELETARLAGRELRFPKEKKDILMLAHTQINGGSLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LIX1-like protein very confidentQ8IVB5
LIX1-like protein very confidentQ5PQQ7
LIX1-like protein very confidentQ8BQ89

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035003 [CC]subapical complexprobableGO:0032991, GO:0043296, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005911, GO:0005886, GO:0044425, GO:0044459, GO:0030054
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B7V, chain A
Confidence level:probable
Coverage over the Query: 2-12,26-49
View the alignment between query and template
View the model in PyMOL