Diaphorina citri psyllid: psy17885


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MNEMGNKRGWRKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
ccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEccccccccEEEEcccccHcccccccccccccccccEEHHHHHHHHHHHcccc
**************APEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEMGNKRGWRKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium voltage-gated channel protein eag Structural component of a potassium channel. Mediates the potassium permeability of membranes; potassium current is regulated by CaMKII and CASK. Has a role in growth of the perineurial glial layer of the larval peripheral nerve.confidentQ02280

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0022843 [MF]voltage-gated cation channel activityconfidentGO:0022891, GO:0022838, GO:0005261, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022892, GO:0022803, GO:0022839, GO:0005244
GO:0007612 [BP]learningprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0007629 [BP]flight behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0042066 [BP]perineurial glial growthprobableGO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0007275, GO:0044699, GO:0016049, GO:0040007, GO:0048869, GO:0032502, GO:0032501, GO:0042065, GO:0042063, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0007399, GO:0044707, GO:0048856, GO:0008150, GO:0009987
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000160 [BP]phosphorelay signal transduction systemprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0007608 [BP]sensory perception of smellprobableGO:0032501, GO:0044707, GO:0050877, GO:0007606, GO:0007600, GO:0008150, GO:0044699, GO:0003008
GO:0000155 [MF]phosphorelay sensor kinase activityprobableGO:0038023, GO:0004673, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016775, GO:0060089, GO:0016740, GO:0003674, GO:0004872, GO:0004871, GO:0004672
GO:0048150 [BP]behavioral response to etherprobableGO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045472, GO:0008150, GO:0042221, GO:0010033, GO:0044699
GO:0008016 [BP]regulation of heart contractionprobableGO:0008150, GO:0065007, GO:0051239, GO:0044057, GO:0050789
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0W, chain A
Confidence level:very confident
Coverage over the Query: 24-85
View the alignment between query and template
View the model in PyMOL
Template: 3EWK, chain A
Confidence level:confident
Coverage over the Query: 2-86
View the alignment between query and template
View the model in PyMOL