Psyllid ID: psy17885

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MNEMGNKRGWRKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
ccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEccccccccEEEEccccHHcccccccccccccccccEEHHHHHHHHHHHcccc
ccccccccccccccccHcHHHHHcEHHcEEEccccccccEEEEEEEEccccEEEEcccccEEccccccccccccccccHHHHHHHHHHHcccccc
mnemgnkrgwrkntapeVELVRRTYMyderqknghpdssfllanaqivdfpivycnesfckisgynraevpsdydiptynlLVGSYLQSLYLPLI
mnemgnkrgwrkntapeveLVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
MNEMGNKRGWRKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
*******************LVRRTYMY***********SFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLP**
**************APEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
**********RKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
***********KNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEMGNKRGWRKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYLQSLYLPLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query95 2.2.26 [Sep-21-2011]
Q02280 1174 Potassium voltage-gated c no N/A 0.431 0.034 0.902 4e-16
Q8NCM2 988 Potassium voltage-gated c no N/A 0.568 0.054 0.5 1e-08
Q920E3 988 Potassium voltage-gated c yes N/A 0.568 0.054 0.5 1e-08
Q9EPI9 988 Potassium voltage-gated c yes N/A 0.568 0.054 0.5 1e-08
O18965 987 Potassium voltage-gated c no N/A 0.357 0.034 0.705 1e-08
Q63472 962 Potassium voltage-gated c no N/A 0.357 0.035 0.705 1e-08
Q60603 989 Potassium voltage-gated c no N/A 0.357 0.034 0.705 1e-08
O95259 989 Potassium voltage-gated c no N/A 0.357 0.034 0.705 1e-08
P59111 1102 Potassium voltage-gated c no N/A 0.347 0.029 0.558 3e-05
Q9QWS8 1102 Potassium voltage-gated c no N/A 0.347 0.029 0.558 3e-05
>sp|Q02280|KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster GN=eag PE=1 SV=2 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (92%)

Query: 30 RQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 70
          R+ N  PDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV
Sbjct: 21 RRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 61
Structural component of a potassium channel. Mediates the potassium permeability of membranes; potassium current is regulated by CaMKII and CASK. Has a role in growth of the perineurial glial layer of the larval peripheral nerve.
Drosophila melanogaster (taxid: 7227)
>sp|Q8NCM2|KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens GN=KCNH5 PE=1 SV=3 Back     alignment and function description
>sp|Q920E3|KCNH5_MOUSE Potassium voltage-gated channel subfamily H member 5 OS=Mus musculus GN=Kcnh5 PE=2 SV=3 Back     alignment and function description
>sp|Q9EPI9|KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus GN=Kcnh5 PE=2 SV=1 Back     alignment and function description
>sp|O18965|KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus GN=KCNH1 PE=2 SV=2 Back     alignment and function description
>sp|Q63472|KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus GN=Kcnh1 PE=1 SV=1 Back     alignment and function description
>sp|Q60603|KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus GN=Kcnh1 PE=1 SV=1 Back     alignment and function description
>sp|O95259|KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens GN=KCNH1 PE=1 SV=1 Back     alignment and function description
>sp|P59111|KCNH8_MOUSE Potassium voltage-gated channel subfamily H member 8 OS=Mus musculus GN=Kcnh8 PE=2 SV=2 Back     alignment and function description
>sp|Q9QWS8|KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus GN=Kcnh8 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
195432719 1267 GK20120 [Drosophila willistoni] gi|19416 0.431 0.032 0.902 1e-14
442616380 1254 ether a go-go, isoform G [Drosophila mel 0.431 0.032 0.902 1e-14
320542083 1268 ether a go-go, isoform D [Drosophila mel 0.431 0.032 0.902 2e-14
116007160 1270 ether a go-go, isoform B [Drosophila mel 0.431 0.032 0.902 2e-14
195478693 1269 GE17158 [Drosophila yakuba] gi|194188140 0.431 0.032 0.902 2e-14
195354621 1257 GM12050 [Drosophila sechellia] gi|194129 0.431 0.032 0.902 2e-14
198471179 1266 GA23028 [Drosophila pseudoobscura pseudo 0.431 0.032 0.902 2e-14
194894876 1227 GG17855 [Drosophila erecta] gi|190649784 0.431 0.033 0.902 2e-14
195130072 1139 GI15206 [Drosophila mojavensis] gi|19390 0.431 0.035 0.902 2e-14
24642070 1174 ether a go-go, isoform A [Drosophila mel 0.431 0.034 0.902 2e-14
>gi|195432719|ref|XP_002064364.1| GK20120 [Drosophila willistoni] gi|194160449|gb|EDW75350.1| GK20120 [Drosophila willistoni] Back     alignment and taxonomy information
 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (92%)

Query: 30 RQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 70
          R+ N  PDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV
Sbjct: 21 RRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 61

Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|442616380|ref|NP_001259558.1| ether a go-go, isoform G [Drosophila melanogaster] gi|440216780|gb|AGB95400.1| ether a go-go, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320542083|ref|NP_001188592.1| ether a go-go, isoform D [Drosophila melanogaster] gi|318069380|gb|ADV37674.1| ether a go-go, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|116007160|ref|NP_001036275.1| ether a go-go, isoform B [Drosophila melanogaster] gi|113193606|gb|ABI30980.1| ether a go-go, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195478693|ref|XP_002100616.1| GE17158 [Drosophila yakuba] gi|194188140|gb|EDX01724.1| GE17158 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195354621|ref|XP_002043795.1| GM12050 [Drosophila sechellia] gi|194129021|gb|EDW51064.1| GM12050 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|198471179|ref|XP_002133679.1| GA23028 [Drosophila pseudoobscura pseudoobscura] gi|198145802|gb|EDY72306.1| GA23028 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194894876|ref|XP_001978135.1| GG17855 [Drosophila erecta] gi|190649784|gb|EDV47062.1| GG17855 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195130072|ref|XP_002009478.1| GI15206 [Drosophila mojavensis] gi|193907928|gb|EDW06795.1| GI15206 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|24642070|ref|NP_511158.2| ether a go-go, isoform A [Drosophila melanogaster] gi|68068030|sp|Q02280.2|KCNAE_DROME RecName: Full=Potassium voltage-gated channel protein eag; AltName: Full=Ether-a-go-go protein gi|7293023|gb|AAF48410.1| ether a go-go, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
FB|FBgn0000535 1174 eag "ether a go-go" [Drosophil 0.431 0.034 0.902 2.7e-14
WB|WBGene00001171 956 egl-2 [Caenorhabditis elegans 0.515 0.051 0.489 1.5e-08
UNIPROTKB|O44164 956 egl-2 "Protein EGL-2" [Caenorh 0.515 0.051 0.489 1.5e-08
UNIPROTKB|J9NSL2 699 KCNH1 "Uncharacterized protein 0.357 0.048 0.705 4.4e-08
UNIPROTKB|E2RSP6 738 KCNH1 "Uncharacterized protein 0.357 0.046 0.705 4.7e-08
UNIPROTKB|F1MP51 988 KCNH5 "Uncharacterized protein 0.357 0.034 0.705 5.4e-08
UNIPROTKB|Q8NCM2 988 KCNH5 "Potassium voltage-gated 0.357 0.034 0.705 5.4e-08
MGI|MGI:3584508 988 Kcnh5 "potassium voltage-gated 0.357 0.034 0.705 5.4e-08
RGD|621417 988 Kcnh5 "potassium voltage-gated 0.357 0.034 0.705 5.4e-08
UNIPROTKB|E1BXK7 989 KCNH5 "Uncharacterized protein 0.357 0.034 0.705 5.4e-08
FB|FBgn0000535 eag "ether a go-go" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 197 (74.4 bits), Expect = 2.7e-14, P = 2.7e-14
 Identities = 37/41 (90%), Positives = 38/41 (92%)

Query:    30 RQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 70
             R+ N  PDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV
Sbjct:    21 RRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 61
GO:0007629 "flight behavior" evidence=IMP
GO:0005249 "voltage-gated potassium channel activity" evidence=IDA;TAS
GO:0008076 "voltage-gated potassium channel complex" evidence=ISS;TAS;IPI
GO:0051259 "protein oligomerization" evidence=IPI
GO:0006813 "potassium ion transport" evidence=IDA;TAS
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0007619 "courtship behavior" evidence=NAS;TAS
GO:0042066 "perineurial glial growth" evidence=IGI
GO:0008016 "regulation of heart contraction" evidence=NAS
GO:0048150 "behavioral response to ether" evidence=NAS
GO:0007608 "sensory perception of smell" evidence=NAS
GO:0007611 "learning or memory" evidence=NAS
GO:0022843 "voltage-gated cation channel activity" evidence=IDA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0007612 "learning" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
WB|WBGene00001171 egl-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O44164 egl-2 "Protein EGL-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSL2 KCNH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSP6 KCNH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MP51 KCNH5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NCM2 KCNH5 "Potassium voltage-gated channel subfamily H member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:3584508 Kcnh5 "potassium voltage-gated channel, subfamily H (eag-related), member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621417 Kcnh5 "potassium voltage-gated channel, subfamily H (eag-related), member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXK7 KCNH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q02280KCNAE_DROMENo assigned EC number0.90240.43150.0349noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
pfam13426101 pfam13426, PAS_9, PAS domain 0.002
PRK13559 361 PRK13559, PRK13559, hypothetical protein; Provisio 0.003
>gnl|CDD|222120 pfam13426, PAS_9, PAS domain Back     alignment and domain information 
 Score = 33.9 bits (78), Expect = 0.002
 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 40 FLLANAQIVDFPIVYCNESFCKISGYNRAEV 70
           L+ +    D  IVY N++  ++ GY R E+
Sbjct: 1  ILVLDP---DGRIVYANDAALRLLGYTREEL 28

Length = 101
>gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 95
KOG0501|consensus 971 99.15
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 98.88
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 98.71
PRK13557 540 histidine kinase; Provisional 98.52
PF1318864 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. 98.45
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 98.37
PRK13559 361 hypothetical protein; Provisional 98.31
PRK13560 807 hypothetical protein; Provisional 98.19
TIGR02966 333 phoR_proteo phosphate regulon sensor kinase PhoR. 98.12
PRK10060 663 RNase II stability modulator; Provisional 98.0
PRK09776 1092 putative diguanylate cyclase; Provisional 98.0
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 97.9
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 97.87
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 97.85
PRK11073 348 glnL nitrogen regulation protein NR(II); Provision 97.84
PRK11006 430 phoR phosphate regulon sensor protein; Provisional 97.76
PRK11091 779 aerobic respiration control sensor protein ArcB; P 97.67
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 97.67
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 97.64
PRK13558 665 bacterio-opsin activator; Provisional 97.59
PRK13560 807 hypothetical protein; Provisional 97.53
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 97.46
PRK09776 1092 putative diguanylate cyclase; Provisional 97.44
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 97.39
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 97.36
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 97.12
smart0009167 PAS PAS domain. PAS motifs appear in archaea, euba 97.11
PF12860115 PAS_7: PAS fold 96.98
PRK11360 607 sensory histidine kinase AtoS; Provisional 96.98
KOG1229|consensus 775 96.97
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 96.9
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 96.61
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 96.44
PRK15053 545 dpiB sensor histidine kinase DpiB; Provisional 95.94
PRK11086 542 sensory histidine kinase DcuS; Provisional 95.81
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 95.36
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 93.93
PRK09959 1197 hybrid sensory histidine kinase in two-component r 92.63
KOG3561|consensus 803 90.67
COG3852 363 NtrB Signal transduction histidine kinase, nitroge 90.59
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 89.93
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 89.57
COG3290 537 CitA Signal transduction histidine kinase regulati 88.73
TIGR02373124 photo_yellow photoactive yellow protein. Members o 87.35
PF08446110 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold 86.1
KOG3558|consensus 768 80.73
>KOG0501|consensus Back     alignment and domain information 
Probab=99.15  E-value=2e-11  Score=101.81  Aligned_cols=77  Identities=44%  Similarity=0.739  Sum_probs=69.0

Q ss_pred             cccceeecccchhhhhhhhHHHHHHHhCCCCCeEEEEecCCCCCcEEEEchHHHHhhCCCccccCCCCCCCCcccccCCC
Q psy17885          7 KRGWRKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSY   86 (95)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gi~I~d~~~~~~~I~yvN~aF~~mtGYs~~EliG~~~~~~~~~L~g~~   86 (95)
                      +-|+||.+||+++     +++-+-+.-+.....+++.+++..|.||+|||+.||+++||+|.|++.+|  |+|.|++|..
T Consensus         2 pgGkRGLVAPQNT-----FLENiiRRsn~~dtsFlL~NAQiVD~PiVY~NdgFcKlsGY~RAevMQKs--~tc~FMyGEl   74 (971)
T KOG0501|consen    2 PGGKRGLVAPQNT-----FLENIIRRSNNADTSFLLANAQIVDWPIVYCNDGFCKLSGYHRAEVMQKS--CTCSFMYGEL   74 (971)
T ss_pred             CCCcccccccchh-----HHHHHHhhccCCCcceeeccceeeccceEEecCcchhccCccHHHHhccc--ceeeeeeccc
Confidence            3489999999995     78877777777788999999999999999999999999999999999996  7899999998


Q ss_pred             CCCC
Q psy17885         87 LQSL   90 (95)
Q Consensus        87 ~~~~   90 (95)
                      ++..
T Consensus        75 tdk~   78 (971)
T KOG0501|consen   75 TDKG   78 (971)
T ss_pred             cchh
Confidence            8764

>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>KOG1229|consensus Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02373 photo_yellow photoactive yellow protein Back     alignment and domain information
>PF08446 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
2l0w_A138 Solution Nmr Structure Of The N-Terminal Pas Domain 3e-05
2l4r_A135 Nmr Solution Structure Of The N-Terminal Pas Domain 3e-05
2l1m_A150 Solution Structure Of The Eag Domain Of The Herg (K 4e-05
1byw_A110 Structure Of The N-Terminal Domain Of The Human-Erg 4e-05
>pdb|2L0W|A Chain A, Solution Nmr Structure Of The N-Terminal Pas Domain Of Herg Potassium Channel Length = 138 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 5/60 (8%)
Query: 11 RKNTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 70
          R + AP+      T++    +K       F++ANA++ +  ++YCN+ FC++ GY+RAEV
Sbjct: 8  RGHVAPQ-----NTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEV 62
>pdb|2L4R|A Chain A, Nmr Solution Structure Of The N-Terminal Pas Domain Of Herg Length = 135 Back     alignment and structure
>pdb|2L1M|A Chain A, Solution Structure Of The Eag Domain Of The Herg (Kv11.1) K+ Channel Length = 150 Back     alignment and structure
>pdb|1BYW|A Chain A, Structure Of The N-Terminal Domain Of The Human-Erg Potassium Channel Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 3e-14
1byw_A110 Protein (human ERG potassium channel); PAS domain, 6e-14
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 5e-12
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 9e-12
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 3e-11
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 4e-11
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 6e-11
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 1e-09
3p7n_A 258 Sensor histidine kinase; LOV domain, light-activat 2e-09
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 7e-09
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 9e-09
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 3e-08
3ewk_A 227 Sensor protein; PAS domain, alpha/beta fold, kinas 2e-04
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 3e-04
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 4e-04
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
 Score = 62.3 bits (152), Expect = 3e-14
 Identities = 15/34 (44%), Positives = 26/34 (76%)

Query: 37 DSSFLLANAQIVDFPIVYCNESFCKISGYNRAEV 70
             F++ANA++ +  ++YCN+ FC++ GY+RAEV
Sbjct: 29 SRKFIIANARVENCAVIYCNDGFCELCGYSRAEV 62
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Length = 120 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.3
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 99.22
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 99.15
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 99.12
2r78_A117 Sensor protein; sensory box sensor histidine kinas 99.07
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 99.02
4hia_A 176 LOV protein; PAS, HTH, signaling protein; HET: FMN 98.97
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 98.93
3olo_A118 Two-component sensor histidine kinase; structural 98.91
3p7n_A 258 Sensor histidine kinase; LOV domain, light-activat 98.85
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 98.83
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 98.81
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 98.8
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 98.79
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 98.78
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 98.76
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 98.74
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 98.71
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 98.68
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 98.68
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 98.64
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 98.64
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 98.63
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.61
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.6
3vol_A 233 Aerotaxis transducer AER2; heme, oxygen sensor pro 98.59
1byw_A110 Protein (human ERG potassium channel); PAS domain, 98.57
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 98.53
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 98.49
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 98.47
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 98.46
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 98.46
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 98.42
3b33_A115 Sensor protein; structural genomics, PAS domain, n 98.4
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 98.39
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 98.37
3ewk_A 227 Sensor protein; PAS domain, alpha/beta fold, kinas 98.35
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 98.28
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 98.27
3mjq_A126 Uncharacterized protein; NESG, structural genomics 98.25
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 98.25
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 98.25
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 98.24
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 98.22
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 98.15
3eeh_A125 Putative light and redox sensing histidine kinase; 98.15
3nja_A125 Probable ggdef family protein; structural genomics 98.15
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 98.13
3a0r_A 349 Sensor protein; four helix bundle, PAS fold, kinas 98.08
3icy_A118 Sensor protein; sensory box histidine kinase/respo 97.93
2qkp_A151 Uncharacterized protein; structural genomics, unkn 97.7
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 97.63
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 97.62
4f3l_A 361 Mclock, circadian locomoter output cycles protein 97.6
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 97.27
3mr0_A142 Sensory box histidine kinase/response regulator; P 97.24
3cax_A369 Uncharacterized protein PF0695; structural genomic 97.14
3rty_A 339 Period circadian protein; PAS domain, signalling, 96.7
3rty_A 339 Period circadian protein; PAS domain, signalling, 96.53
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 96.47
4f3l_A361 Mclock, circadian locomoter output cycles protein 96.4
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 96.31
4dj2_A 320 Period circadian protein homolog 1; PAS domains, c 96.29
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 95.99
3gdi_A 309 Period circadian protein homolog 2; tandem PAS dom 95.98
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 94.91
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 95.91
4dj3_A 317 Period circadian protein homolog 3; PAS domain, ci 95.59
4ew7_A127 Conjugative transfer: regulation; alpha-beta-alpha 93.4
2ool_A 337 Sensor protein; bacteriophytochrome, photoconversi 90.5
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
Probab=99.30  E-value=4.8e-12  Score=88.08  Aligned_cols=78  Identities=17%  Similarity=0.283  Sum_probs=65.0

Q ss_pred             CCcCCccccee-ecccchhhhhhhhHHHHHHHhCCCCCeEEEEecCCCCCcEEEEchHHHHhhCCCccccCCCCCCCCcc
Q psy17885          2 NEMGNKRGWRK-NTAPEVELVRRTYMYDERQKNGHPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYN   80 (95)
Q Consensus         2 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~gi~I~d~~~~~~~I~yvN~aF~~mtGYs~~EliG~~~~~~~~   80 (95)
                      ++.|...|.++ ..+++.+...+..+..++++++..+++++++|..   +.|+|+|++|++++||+++|++|+    ++.
T Consensus        85 d~~g~~~~~~~~~~DIT~~k~~e~~l~~~~~~~~~~~~~i~~~d~~---g~i~~~N~~~~~~~G~~~~e~~g~----~~~  157 (227)
T 3ewk_A           85 DNAGKPRQYISIRRDITAQKEAEAQLARLKQAMDANSEMILLTDRA---GRIIYANPALCRFSGMAEGELLGQ----SPS  157 (227)
T ss_dssp             CSSSCEEEEEEEEEECTTTTHHHHHHHHHHHHHHTCCSEEEEECTT---SCEEEECHHHHHHHTCCTHHHHSS----CGG
T ss_pred             cCCCCEEEEEEEEEehhhHHHHHHHHHHHHHHHhcCcCeEEEEcCC---CcEEEEchHHHHHhCCCHHHHcCC----Chh
Confidence            35566667777 6777777777777788899999999999999977   799999999999999999999999    777


Q ss_pred             cccCCC
Q psy17885         81 LLVGSY   86 (95)
Q Consensus        81 ~L~g~~   86 (95)
                      .|..+.
T Consensus       158 ~l~~~~  163 (227)
T 3ewk_A          158 ILDSPL  163 (227)
T ss_dssp             GGBCTT
T ss_pred             hccCCC
Confidence            776543
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>4ew7_A Conjugative transfer: regulation; alpha-beta-alpha structure, structural genomics, midwest CEN structural genomics (MCSG), PSI-biology; 1.67A {Salmonella enterica subsp} Back     alignment and structure
>2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 95
d1bywa_110 d.110.3.6 (A:) Erg potassium channel, N-terminal d 2e-09
d1n9la_109 d.110.3.6 (A:) Putative blue light receptor, phot- 1e-08
d1jnua_104 d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d 5e-08
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Erg potassium channel, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 48.5 bits (114), Expect = 2e-09
 Identities = 15/33 (45%), Positives = 26/33 (78%)

Query: 39 SFLLANAQIVDFPIVYCNESFCKISGYNRAEVP 71
           F++ANA++ +  ++YCN+ FC++ GY+RAEV 
Sbjct: 3  KFIIANARVENCAVIYCNDGFCELCGYSRAEVM 35
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 99.35
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 99.25
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.09
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 99.09
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 98.96
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 98.91
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 98.87
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 98.87
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 98.77
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 97.92
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 96.42
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 95.79
d2veaa3127 Phytochrome-like protein Cph1 {Synechocystis sp. p 91.33
d2o9ca2127 Bacteriophytochrome BphP {Deinococcus radiodurans 90.16
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Putative blue light receptor, phot-lov1 domain
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

Probab=99.35  E-value=4.6e-13  Score=83.76  Aligned_cols=48  Identities=31%  Similarity=0.582  Sum_probs=43.3

Q ss_pred             CCCeEEEEecCCCCCcEEEEchHHHHhhCCCccccCCCCCCCCcccccCCCC
Q psy17885         36 PDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVPSDYDIPTYNLLVGSYL   87 (95)
Q Consensus        36 ~~~gi~I~d~~~~~~~I~yvN~aF~~mtGYs~~EliG~~~~~~~~~L~g~~~   87 (95)
                      ..++++|+|++.++++|+|||++|++|+||+++|++|+    ++.+|..+..
T Consensus         2 i~~~~vi~Da~~pdg~Ii~vN~a~~~~~Gy~~~El~G~----~~~~l~~~~~   49 (109)
T d1n9la_           2 LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGH----NCRFLQGEGT   49 (109)
T ss_dssp             CSCEEEEEETTSTTCCEEEECHHHHHHHCCCHHHHTTS----CGGGGCCTTC
T ss_pred             ccceEEEEeCCCCCCeEEEEcHHHHHHHCcCHHHHcCC----cceeeecccC
Confidence            46899999999889999999999999999999999999    8888876554
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure