Diaphorina citri psyllid: psy17890


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MIVCDPSQNKVHYEGWVPHSLHYRNDDQRLTREAMERYLRDRSDMVIVILHAKVAQKSYGNEKRFFCPPPCIYLYGEGWRLRQEQLLREGESEQAAQLCAFIGIGNSDQDMQQLDLNN
cccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccEEEEEcccccccHHHHHHHccccccccEEEEEEEcccccccccccccc
**************************DQRLTREAMERYLRDRSDMVIVILHAKVAQKSYGNEKRFFCPPPCIYLYGEGWRLRQEQLLR*****QAAQLCAFIGIGNS***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVCDPSQNKVHYEGWVPHSLHYRNDDQRLTREAMERYLRDRSDMVIVILHAKVAQKSYGNEKRFFCPPPCIYLYGEGWRLRQEQLLREGESEQAAQLCAFIGIGNSDQDMQQLDLNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Suppressor of hairless protein Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Binds directly the 5'-GTGRGAR-3' DNA consensus sequence, which is present in the regulatory region of several genes. Required for neurogenesis in imaginal disks. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some Notch protein, it acts as a transcriptional activator that activates transcription of Notch target genes. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Required for transcription of Sim. Also functions independently of Notch pathway, in the development of the bristle sensory organ precursor cell.confidentP28159
Recombining binding protein suppressor of hairless Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA.confidentQ3SZ41
Recombining binding protein suppressor of hairless Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA.confidentP31266

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0001757 [BP]somite specificationprobableGO:0032502, GO:0007389, GO:0061053, GO:0009653, GO:0009880, GO:0044707, GO:0007379, GO:0032501, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0003002, GO:0048646, GO:0008150, GO:0043009, GO:0001756, GO:0035282, GO:0044699, GO:0009952
GO:0072149 [BP]glomerular visceral epithelial cell fate commitmentprobableGO:0061005, GO:0030154, GO:0048468, GO:0072314, GO:0072311, GO:0072073, GO:0044699, GO:0072112, GO:0072010, GO:0048869, GO:0001822, GO:0007275, GO:0008150, GO:0061318, GO:0035850, GO:0030855, GO:0002064, GO:0032502, GO:0060429, GO:0032501, GO:0032835, GO:0009888, GO:0044767, GO:0044763, GO:0001655, GO:0072148, GO:0072001, GO:0072006, GO:0048513, GO:0045165, GO:0044707, GO:0048856, GO:0048731, GO:0009987
GO:0002193 [CC]MAML1-RBP-Jkappa- ICN1 complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0000979 [MF]RNA polymerase II core promoter sequence-specific DNA bindingprobableGO:0044212, GO:0003676, GO:0043565, GO:0001067, GO:0000975, GO:0001012, GO:0000976, GO:0000977, GO:0001047, GO:0001046, GO:0003674, GO:0097159, GO:0003677, GO:1901363, GO:0005488
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0007221 [BP]positive regulation of transcription of Notch receptor targetprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0010628, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0080090, GO:0051716, GO:0007219, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0045893, GO:2001141, GO:0007154, GO:0044700, GO:0050896, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0008150, GO:0048522
GO:0008356 [BP]asymmetric cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0051301
GO:0007616 [BP]long-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0007367 [BP]segment polarity determinationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0007365, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699
GO:0016360 [BP]sensory organ precursor cell fate determinationprobableGO:0060582, GO:0032501, GO:0060581, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0010160, GO:0048869, GO:0001709, GO:0048513, GO:0048645, GO:0048646, GO:0032502, GO:0009887, GO:0030154, GO:0009987, GO:0044767, GO:0008052, GO:0008150, GO:0003002, GO:0048731, GO:0045165, GO:0048859, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0039021 [BP]pronephric glomerulus developmentprobableGO:0032502, GO:0048856, GO:0044707, GO:0032501, GO:0032835, GO:0039019, GO:0048793, GO:0001822, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0007275, GO:0048731, GO:0072001, GO:0072006, GO:0044699
GO:0039022 [BP]pronephric duct developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0048793, GO:0001822, GO:0044767, GO:0072176, GO:0048513, GO:0008150, GO:0001655, GO:0007275, GO:0048731, GO:0035295, GO:0072001, GO:0044699
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045750 [BP]positive regulation of S phase of mitotic cell cycleprobable
GO:0030325 [BP]adrenal gland developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0035270, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003140 [BP]determination of left/right asymmetry in lateral mesodermprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0007498, GO:0007368, GO:0048856, GO:0009888, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699, GO:0048368
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0042688 [BP]crystal cell differentiationprobableGO:0032502, GO:0042386, GO:0009987, GO:0048869, GO:0030154, GO:0002376, GO:0008150, GO:0044763, GO:0044699
GO:0042683 [BP]negative regulation of compound eye cone cell fate specificationprobableGO:0051093, GO:0009996, GO:0022603, GO:0050793, GO:0010453, GO:0010454, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0042659, GO:2000027, GO:0051239, GO:0048519, GO:0042682, GO:2000026, GO:0050789, GO:0048523
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0002040 [BP]sprouting angiogenesisprobableGO:0032502, GO:0032501, GO:0009653, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0044699, GO:0048731, GO:0008150, GO:0001525, GO:0007275, GO:0048646
GO:0001103 [MF]RNA polymerase II repressing transcription factor bindingprobableGO:0001085, GO:0008134, GO:0003674, GO:0005488, GO:0005515, GO:0070491
GO:0030097 [BP]hemopoiesisprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0048190 [BP]wing disc dorsal/ventral pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0007444, GO:0007450, GO:0048856, GO:0035222, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007447, GO:0007275, GO:0044699
GO:0032993 [CC]protein-DNA complexprobableGO:0005575, GO:0032991

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IAG, chain C
Confidence level:very confident
Coverage over the Query: 27-118
View the alignment between query and template
View the model in PyMOL