Diaphorina citri psyllid: psy17891


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MGRDRFNRGDKPTIYCEGLNSSEIEEEEDRIGESQPFLEQTGRYFYLGTYIGKDEDKQHGGCEGPNAMYVKLISSDGHEFIVKREHALMSGTIKAMLSGPGQFAENETNEINFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPIAPAIALELLMAANFLDC
cccccccccccccccccccccccccHHHHHcccccccHHHccccccccCCccccccccccccccccccEEEEEcccccEEEEcHHHHHHHHHHHHHHcccccccccccccEEcccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccc
************************************FLEQTGR**********D**KQHGGCEGPNAMYVKLISSDGHEFIVKREHALMSGTIKAMLSGPGQFAENETNEINFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPIAPAIALELLMAANFLDC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRDRFNRGDKPTIYCEGLNSSEIEEEEDRIGESQPFLEQTGRYFYLGTYIGKDEDKQHGGCEGPNAMYVKLISSDGHEFIVKREHALMSGTIKAMLSGPGQFAENETNEINFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPIAPAIALELLMAANFLDC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription elongation factor B polypeptide 1 The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.very confidentP83940
Transcription elongation factor B polypeptide 1 The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.very confidentP83941
Transcription elongation factor B polypeptide 1 The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.very confidentQ2KII4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030891 [CC]VCB complexconfidentGO:0005737, GO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0000153, GO:0005575, GO:0044444, GO:0044424, GO:0005622
GO:0032968 [BP]positive regulation of transcription elongation from RNA polymerase II promoterconfidentGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0034243, GO:0060255, GO:0032784, GO:0009889, GO:0032786, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0031462 [CC]Cul2-RING ubiquitin ligase complexconfidentGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050434 [BP]positive regulation of viral transcriptionconfidentGO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:0019219, GO:0065007, GO:0046782, GO:0031326, GO:0048518, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0051171, GO:2001141, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0048522
GO:0005654 [CC]nucleoplasmconfidentGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006368 [BP]transcription elongation from RNA polymerase II promoterconfidentGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0006511 [BP]ubiquitin-dependent protein catabolic processconfidentGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0032403 [MF]protein complex bindingconfidentGO:0003674, GO:0005488, GO:0005515
GO:0061418 [BP]regulation of transcription from RNA polymerase II promoter in response to hypoxiaconfidentGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0001666, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0071453, GO:0010556, GO:0065007, GO:0071456, GO:0043620, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0044763, GO:0051171, GO:2001141, GO:0042221, GO:0070482, GO:0009628, GO:0036293, GO:0050896, GO:0051252, GO:0036294, GO:0006355, GO:0006357, GO:0033554, GO:0008150
GO:0016032 [BP]viral reproductionconfidentGO:0009987, GO:0044764, GO:0008150, GO:0051704
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0007138 [BP]meiotic anaphase IIprobableGO:0007126, GO:0048610, GO:0000279, GO:0000003, GO:0051322, GO:0007049, GO:0009987, GO:0044699, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0051321, GO:0007135
GO:0019048 [BP]virus-host interactionprobableGO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0040007 [BP]growthprobableGO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0051759 [BP]sister chromosome movement towards spindle pole involved in meiotic sister chromatid segregationprobableGO:0048610, GO:0006928, GO:0022402, GO:0051305, GO:0051656, GO:0051303, GO:0044699, GO:0007126, GO:0051321, GO:0000003, GO:0071840, GO:0045132, GO:0016043, GO:0007049, GO:0051641, GO:0016344, GO:0009987, GO:0044763, GO:0051649, GO:0007059, GO:0051234, GO:0045144, GO:0051179, GO:0007135, GO:0051276, GO:0006996, GO:0007017, GO:0000819, GO:0070192, GO:0007018, GO:0050000, GO:0051640, GO:0008150
GO:0008595 [BP]anterior/posterior axis specification, embryoprobableGO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0009948, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0000578, GO:0009798, GO:0007351, GO:0007350, GO:0035282, GO:0044699, GO:0009880
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008023 [CC]transcription elongation factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VCB, chain B
Confidence level:very confident
Coverage over the Query: 68-163
View the alignment between query and template
View the model in PyMOL