Diaphorina citri psyllid: psy17893


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MSGLELERDLISIMSDLIDMSVPMTPRKCVCPTTLDSKSIKSAYEDVRSDASQTQWAVFKYQDSKISCTARGQSFDKFRAQFRPDERSFGYLRMMTGDEMSRRLKFLLITWVGCEVGVIQRAKVSIDKALVKSVITFKFKFKF
ccccccHHHHHHHHcccEEEEECcccCECcccccccHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEccccHHHHHHHcccccEEEEEEEEEEcccccccEEEEEEEEEccccccccHHHccccHHHHHHHHccccEEEc
*********LISIMSDLIDMSVPMTPRKCVCPTTLD***IKSAYEDVRSDASQTQWAVFKYQDSKISCTARGQSFDKFRAQFRPDERSFGYLRMMTGDEMSRRLKFLLITWVGCEVGVIQRAKVSIDKALVKSVITFKFKFKF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGLELERDLISIMSDLIDMSVPMTPRKCVCPTTLDSKSIKSAYEDVRSDASQTQWAVFKYQDSKISCTARGQSFDKFRAQFRPDERSFGYLRMMTGDEMSRRLKFLLITWVGCEVGVIQRAKVSIDKALVKSVITFKFKFKF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coactosin-like protein Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization.confidentQ9CQI6
Coactosin-like protein Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization.confidentB0BNA5
Coactosin-like protein Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization.confidentQ2HJ57

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050832 [BP]defense response to fungusprobableGO:0009607, GO:0009620, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030833 [BP]regulation of actin filament polymerizationprobableGO:0033043, GO:0051128, GO:0008064, GO:0050789, GO:0044699, GO:0030832, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0071840, GO:0065008, GO:0032271, GO:0032970, GO:0009987, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0044087, GO:0008150, GO:0032535

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T3Y, chain A
Confidence level:very confident
Coverage over the Query: 33-140
View the alignment between query and template
View the model in PyMOL