Diaphorina citri psyllid: psy17909


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MALGDTLFVAGAGKFFEGDGAFVTSPLSGDTLFVAGAGKFFEGDGAEMHHNLNVKLAKLPNETKVFCGHEYTVNNLYFSKHVEPNNTRIAEKLKWAIEKRERKEPTVPSTIGMVMVMGTVMGMVMVVGMVTDTTITITTP
cccccEEEccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHccccccccEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccc
MALGDTLFVAGAGKFFEGDGAFVTSPLSGDTLFVAGAGKFFEGDGAEMHHNLNVKLAKLPNETKVFCGHEYTVNNLYFSKHVEPNNTRIAEKLKWAIEKRERKEPTVPSTIGMVMVMGTVMGMVMVVGMVTDTTITI***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALGDTLFVAGAGKFFEGDGAFVTSPLSGDTLFVAGAGKFFEGDGAEMHHNLNVKLAKLPNETKVFCGHEYTVNNLYFSKHVEPNNTRIAEKLKWAIEKRERKEPTVPSTIGMVMVMGTVMGMVMVVGMVTDTTITITTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hydroxyacylglutathione hydrolase Thiolesterase that catalyzes the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid.confidentA4G7G5
Hydroxyacylglutathione hydrolase, mitochondrial Thiolesterase that catalyzes the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid.confidentQ99KB8
Hydroxyacylglutathione hydrolase cytoplasmic Thiolesterase that catalyzes the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid.confidentO24496

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004416 [MF]hydroxyacylglutathione hydrolase activityprobableGO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824
GO:0006750 [BP]glutathione biosynthetic processprobableGO:0044238, GO:0042398, GO:0019752, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0043043, GO:0071704, GO:0019184, GO:0006749, GO:0043604, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044271, GO:0008652, GO:1901564, GO:0006575, GO:1901566, GO:0044272, GO:0046394, GO:0016053, GO:0044237, GO:0006790, GO:0043603, GO:0006518, GO:0006082
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005975 [BP]carbohydrate metabolic processprobableGO:0044238, GO:0008150, GO:0008152, GO:0071704

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QH5, chain A
Confidence level:very confident
Coverage over the Query: 2-125
View the alignment between query and template
View the model in PyMOL