Diaphorina citri psyllid: psy17930

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MEKADGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVSLSTDISSDDGAKHPS
cccccccccccccccccccccccEEEEcccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccc
****************TLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYL***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKADGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVSLSTDISSDDGAKHPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008593 [BP]regulation of Notch signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0007424 [BP]open tracheal system developmentprobableGO:0060541, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007035 [BP]vacuolar acidificationprobableGO:0019725, GO:0042592, GO:0044699, GO:0045851, GO:0008150, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0055080, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0051453, GO:0051452, GO:0055082, GO:0065008, GO:0030641

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
4aow, chain A probable Alignment | Template Structure