Psyllid ID: psy17930


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MEKADGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVSLSTDISSDDGAKHPS
cccccccccccccccccccccccEEEEcccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHcccccccccccccccccccccc
cccccccccccccccccccHHHHHEEEEccccccEEEEEEEcccccccEcccccccccccccccEEccccHHHHHHHHHHHHHHHccccccccccccccccccccccccc
mekadgggqgpsrsvKTLEGSVSNMLVTSCRDNICRLWvetvlpddglinmsqfdpmaaqnpkfiqvtptlDRDMYNLLQCGMdtylategslvslstdissddgakhps
mekadgggqgpsrsvktlegsvsNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVslstdissddgakhps
MEKADGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVSLSTDISSDDGAKHPS
**********************SNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLV****************
****************TLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMS**********************************************************
**************VKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVSLST************
****************TLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYL***********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKADGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVSLSTDISSDDGAKHPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
Q9Y485 3027 DmX-like protein 1 OS=Hom yes N/A 0.281 0.010 0.612 5e-06
Q8TDJ6 3036 DmX-like protein 2 OS=Hom no N/A 0.272 0.009 0.633 9e-06
Q8BPN8 3032 DmX-like protein 2 OS=Mus yes N/A 0.281 0.010 0.612 9e-06
Q6PNC0 3013 DmX-like protein 1 OS=Mus no N/A 0.281 0.010 0.580 1e-05
>sp|Q9Y485|DMXL1_HUMAN DmX-like protein 1 OS=Homo sapiens GN=DMXL1 PE=1 SV=3 Back     alignment and function desciption
 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (80%)

Query: 19  EGSVSNMLVTSCRDNICRLWVETVLPDDGLI 49
             SV N+L+T C+DN+CRLWVET LP+D L+
Sbjct: 248 RASVCNVLLTCCKDNVCRLWVETFLPNDCLL 278





Homo sapiens (taxid: 9606)
>sp|Q8TDJ6|DMXL2_HUMAN DmX-like protein 2 OS=Homo sapiens GN=DMXL2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BPN8|DMXL2_MOUSE DmX-like protein 2 OS=Mus musculus GN=Dmxl2 PE=1 SV=3 Back     alignment and function description
>sp|Q6PNC0|DMXL1_MOUSE DmX-like protein 1 OS=Mus musculus GN=Dmxl1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
242016272 3332 rabconnectin, putative [Pediculus humanu 0.418 0.013 0.847 4e-18
3096961 3512 CPY [Chironomus thummi] 0.418 0.013 0.891 5e-18
328707852 3061 PREDICTED: dmX-like protein 2-like isofo 0.518 0.018 0.693 1e-17
328707848 3305 PREDICTED: dmX-like protein 2-like isofo 0.518 0.017 0.693 1e-17
328707850 3333 PREDICTED: dmX-like protein 2-like isofo 0.518 0.017 0.693 1e-17
312374859 3240 hypothetical protein AND_15411 [Anophele 0.418 0.014 0.847 2e-17
157113444 3324 rabconnectin [Aedes aegypti] gi|10887771 0.418 0.013 0.847 2e-17
170045722 3407 rabconnectin [Culex quinquefasciatus] gi 0.418 0.013 0.847 2e-17
1279384 3429 hypothetical protein [Drosophila melanog 0.418 0.013 0.804 3e-17
195340416 3418 GM12586 [Drosophila sechellia] gi|194130 0.418 0.013 0.804 4e-17
>gi|242016272|ref|XP_002428753.1| rabconnectin, putative [Pediculus humanus corporis] gi|212513438|gb|EEB16015.1| rabconnectin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 39/46 (84%), Positives = 45/46 (97%)

Query: 19  EGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKF 64
           +GSVSNMLVTSC+DNICR+WVET+LPDDGL+NM QFDP+AAQNPKF
Sbjct: 290 KGSVSNMLVTSCKDNICRIWVETILPDDGLVNMYQFDPLAAQNPKF 335




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|3096961|emb|CAA57760.1| CPY [Chironomus thummi] Back     alignment and taxonomy information
>gi|328707852|ref|XP_003243523.1| PREDICTED: dmX-like protein 2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328707848|ref|XP_003243521.1| PREDICTED: dmX-like protein 2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328707850|ref|XP_003243522.1| PREDICTED: dmX-like protein 2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312374859|gb|EFR22333.1| hypothetical protein AND_15411 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157113444|ref|XP_001657831.1| rabconnectin [Aedes aegypti] gi|108877718|gb|EAT41943.1| AAEL006472-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|170045722|ref|XP_001850447.1| rabconnectin [Culex quinquefasciatus] gi|167868657|gb|EDS32040.1| rabconnectin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|1279384|emb|CAA65830.1| hypothetical protein [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195340416|ref|XP_002036809.1| GM12586 [Drosophila sechellia] gi|194130925|gb|EDW52968.1| GM12586 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
FB|FBgn0023458 3429 Rbcn-3A "Rabconnectin-3A" [Dro 0.418 0.013 0.804 1.7e-16
MGI|MGI:2443926 3013 Dmxl1 "Dmx-like 1" [Mus muscul 0.236 0.008 0.692 2.5e-05
MGI|MGI:2444630 3032 Dmxl2 "Dmx-like 2" [Mus muscul 0.272 0.009 0.633 5.3e-05
UNIPROTKB|Q8TDJ6 3036 DMXL2 "DmX-like protein 2" [Ho 0.272 0.009 0.633 5.3e-05
RGD|1586163 3055 Dmxl2 "Dmx-like 2" [Rattus nor 0.272 0.009 0.633 5.3e-05
FB|FBgn0023458 Rbcn-3A "Rabconnectin-3A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 220 (82.5 bits), Expect = 1.7e-16, Sum P(2) = 1.7e-16
 Identities = 37/46 (80%), Positives = 45/46 (97%)

Query:    19 EGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKF 64
             +GSV+NMLVTSC DNICR+W+ETVLPDDG++NM+QFDPMA+QNPKF
Sbjct:   279 KGSVANMLVTSCLDNICRIWIETVLPDDGMVNMTQFDPMASQNPKF 324


GO:0007424 "open tracheal system development" evidence=IMP
GO:0008593 "regulation of Notch signaling pathway" evidence=IMP
GO:0007035 "vacuolar acidification" evidence=IMP
MGI|MGI:2443926 Dmxl1 "Dmx-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2444630 Dmxl2 "Dmx-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TDJ6 DMXL2 "DmX-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1586163 Dmxl2 "Dmx-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
KOG1064|consensus 2439 99.65
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 94.3
smart0032040 WD40 WD40 repeats. Note that these repeats are per 91.86
KOG0272|consensus459 83.14
>KOG1064|consensus Back     alignment and domain information
Probab=99.65  E-value=3.3e-17  Score=157.24  Aligned_cols=53  Identities=45%  Similarity=0.721  Sum_probs=48.7

Q ss_pred             cCCCCccCCcccccccccccceeeeeeeeCceeeEEeeecCCCCCcccccccC
Q psy17930          3 KADGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFD   55 (110)
Q Consensus         3 ~~~~g~~wrktsrYMprg~V~NVLLT~C~DniCRiW~ET~lPeDsLL~~s~~~   55 (110)
                      ++--||+||||++|||||+|||||+|||+||+||||+||.+|+|+++++..+.
T Consensus       220 ~~Vs~~~WRktskymp~gsv~nvL~T~C~D~v~RIW~et~~p~~~l~~~~~~~  272 (2439)
T KOG1064|consen  220 RRVSGFQWRKTSKYMPRGSVSNVLMTCCLDNVCRIWCETDLPKDCLVMLTGFD  272 (2439)
T ss_pred             cccccceeccccccCCccchhhhHHhhhccCceEEEEEeccCCCeEeeecccc
Confidence            34569999999999999999999999999999999999999999999766654



>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 86.35
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 84.92
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 81.2
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
Probab=86.35  E-value=0.31  Score=33.28  Aligned_cols=16  Identities=25%  Similarity=0.733  Sum_probs=14.7

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      +.|+|++.|+++|||.
T Consensus        52 ~~l~S~s~D~~i~vWd   67 (340)
T 4aow_A           52 DMILSASRDKTIIMWK   67 (340)
T ss_dssp             TEEEEEETTSCEEEEE
T ss_pred             CEEEEEcCCCeEEEEE
Confidence            5789999999999996



>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 89.97
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 88.64
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 88.5
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 88.03
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 85.32
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 84.35
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 84.15
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 84.1
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 83.73
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 82.8
d1tbga_340 beta1-subunit of the signal-transducing G protein 82.62
d1emxa_30 Heteropdatoxin 2, hptx2 {Giant crab spider (Hetero 82.16
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 80.35
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: Cell cycle arrest protein BUB3
domain: Cell cycle arrest protein BUB3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=89.97  E-value=0.068  Score=33.40  Aligned_cols=22  Identities=9%  Similarity=0.110  Sum_probs=17.3

Q ss_pred             ccccccccceeeeeeeeCceeeEEe
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWV   39 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~   39 (110)
                      .|-|.+   +.|+|++.|+++|||.
T Consensus        18 ~fsp~~---~~L~s~s~Dg~v~iwd   39 (342)
T d1yfqa_          18 KIIPSK---SLLLITSWDGSLTVYK   39 (342)
T ss_dssp             EEEGGG---TEEEEEETTSEEEEEE
T ss_pred             EEeCCC---CEEEEEECCCeEEEEE
Confidence            345544   5789999999999994



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1emxa_ g.3.6.2 (A:) Heteropdatoxin 2, hptx2 {Giant crab spider (Heteropoda venatoria) [TaxId: 152925]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure