Diaphorina citri psyllid: psy18006

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MCLQTKILGSGAEVSVSIPPTRHDIIHTCDIYEDIAIAYGYNNIPKTMPRFASIARQVPLNKLSDQLRGDIAQAGFTEVLTFALCSRDDVSVKLRQKMEFIPAVHIGNPKTLEFQIARTTLVPGLLKTLAANKKMPLPLKLFEISDIVYKDATAGTLMFTPGGNRTRDLAISRQTRYRPS
ccCEEEEEECccEEEEEccccccccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccEEECcccccccccccccccHHHHHHHHHcccccc
*CLQTKILGSGAEVSVSIPPTRHDIIHTCDIYEDIAIAYGYNNIPKTMPRFASIARQVPLNKLSDQLRGDIAQAGFTEVLTFALCSRDDVSVKLRQKMEFIPAVHIGNPKTLEFQIARTTLVPGLLKTLAANKKMPLPLKLFEISDIVYKDATAGTLMFTPGGNRTRDLAISRQTRY***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLQTKILGSGAEVSVSIPPTRHDIIHTCDIYEDIAIAYGYNNIPKTMPRFASIARQVPLNKLSDQLRGDIAQAGFTEVLTFALCSRDDVSVKLRQKMEFIPAVHIGNPKTLEFQIARTTLVPGLLKTLAANKKMPLPLKLFEISDIVYKDATAGTLMFTPGGNRTRDLAISRQTRYRPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phenylalanine--tRNA ligase beta subunit confidentQ19713
Phenylalanine--tRNA ligase beta subunit confidentQ9NSD9
Probable phenylalanine--tRNA ligase beta subunit confidentQ9VCA5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L4G, chain B
Confidence level:very confident
Coverage over the Query: 2-165
View the alignment between query and template
View the model in PyMOL