Diaphorina citri psyllid: psy18018

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----

MSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVDSK

cccccEEEEEEccccccccEECcccccEEEEEEEcccccccccEEEEcccccEEEEEccccEEEcccccccccEEECcccccEEEEECccccEEEEECcccEEEEEEcccccEEEEEECccccEEEEEccccEEEEEEccccccEEEEEEcccEEEEEEccccEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccEEEEECccccEEEEccccccEEEccccccccccccccccEEEEEEEccccEEEccccccEEEEEEcccccEEEEEEEEEEEEEEEcccccHHcccccccEECccccccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccEEEEECccccEEEEEcccccccEEEEEEEccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEcccEEEEECccccEEEEEccccCEEEEECcccccEEEEEEEEccccEEEEECccccEEEEEcccccEEEEEcccccccccccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEcccccccccccEEEEEEcccccEEEEECccccccccEEEEEcccccc

*SHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVD**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 17-110,132-238,249-252,341-392,424-482
View the alignment between query and template
View the model in PyMOL

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 135-230,349-392,424-537,549-578
View the alignment between query and template
View the model in PyMOL

Template: 3DM0, chain A
Confidence level:very confident
Coverage over the Query: 73-113,130-171,213-252,373-394,424-579
View the alignment between query and template
View the model in PyMOL

Template: 3DM0, chain A
Confidence level:very confident
Coverage over the Query: 349-409,443-536,549-627
View the alignment between query and template
View the model in PyMOL

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 16-256,286-537,549-626
View the alignment between query and template
View the model in PyMOL

Template: 2OVP, chain B
Confidence level:very confident
Coverage over the Query: 267-537,566-579,604-634
View the alignment between query and template
View the model in PyMOL