Psyllid ID: psy18018


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----
MSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVDSK
cccccEEEEEEccccccccEEEcccccEEEEEEEcccccccccEEEEcccccEEEEEccccEEEcccccccccEEEEcccccEEEEEEccccEEEEEEcccEEEEEEcccccEEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccEEEEEEccccEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccEEEEEEccccEEEEccccccEEEccccccccccccccccEEEEEEEccccEEEccccccEEEEEEcccccEEEEEEEEEEEEEEEcccccHHcccccccEEEccccccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEEEccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEcccEEEEEEccccEEEEEccccEEEEEEEcccccEEEEEEEEccccEEEEEEccccEEEEEcccccEEEEEcccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccccccccEEEEEEcccccEEEEEEccccccccEEEEEcccccc
cccccEEEEEEcccccEEEEEccccccEEEEEEEEccEcccccEEEEcccccEEEEccccEEEEEEcccccEEEEEccccccEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEEccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccEEEEcccccEEEEEEccccEEEEcccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEcccccEEEEEcccccccccccccEccccccccccEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccccccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccccccccccEEEEEEcccccEEEEEcccccccEEEEEEEEccccc
mshrsveinwrtrpikdpkvlkghddhvITCLqfsgksfpcesfirssspwkALFMSHRSVeinwrtrpikdpkvlkghddhvitclqfsgsrivsgsddntLKVWSATTGkcllvsgsrdatLRVWHIESGECLHVLVGHLAAVRcvqydgklvvSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSrivsgsddntlKVWSATTGKCLRTLightggvwssqmagniiisgstdrtlkgwsNAERILAIGQlidsceptQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLhrnkkthvpdlfgfqfdgvhvvSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNIlvsgnadstvKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNIlvsgnadstvKVWDIVsgqclqtlsgrnkhqsAVTCLQFNsrfvitssddgtvklwdvktgefstplmssfilnpfyfliysqpllcphlqfnsrfvitssddgtvklwdVKTGEFIRNLVsldsggsggvVWRIRASETKLVCavgsrngteeTKLLVLDFDVDSK
mshrsveinwrtrpikdpkvlkgHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRsveinwrtrpikdpkvlkghDDHVITCLQfsgsrivsgsddNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSrivsgsddntLKVWSATTGKCLRTLIGhtggvwssqmAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILvsgnadstvkVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRfvitssddgtvKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRnlvsldsggsggvVWRIRASETKLvcavgsrngteetkllvldfdvdsk
MSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNlvsldsggsggvvWRIRASETKLVCAVGSRNGTEETKLLVLDFDVDSK
********NWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDF*****
*SHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVD**
MSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVDSK
***RSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDV***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVDSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query635 2.2.26 [Sep-21-2011]
Q969H0707 F-box/WD repeat-containin yes N/A 0.535 0.480 0.454 1e-109
Q8VBV4629 F-box/WD repeat-containin no N/A 0.535 0.540 0.450 1e-108
Q9VZF41326 F-box/WD repeat-containin yes N/A 0.6 0.287 0.431 1e-94
Q61FW2589 F-box/WD repeat-containin N/A N/A 0.6 0.646 0.286 4e-51
Q93794587 F-box/WD repeat-containin yes N/A 0.6 0.649 0.297 2e-50
Q8YRI11526 Uncharacterized WD repeat yes N/A 0.867 0.361 0.287 3e-48
Q8YTC21258 Uncharacterized WD repeat no N/A 0.771 0.389 0.275 9e-46
Q008081356 Vegetative incompatibilit no N/A 0.636 0.297 0.282 2e-37
Q8YV571683 Uncharacterized WD repeat no N/A 0.8 0.301 0.258 4e-37
Q9UKB1542 F-box/WD repeat-containin no N/A 0.499 0.584 0.234 1e-31
>sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 Back     alignment and function desciption
 Score =  397 bits (1021), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 237/522 (45%), Positives = 282/522 (54%), Gaps = 182/522 (34%)

Query: 243 RTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQP 302
           +  + WS  E++LA+ +LIDSCEPTQ++HMMQ+IEPQFQRDFISLLP+ELALYVL+FL+P
Sbjct: 239 KMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEP 298

Query: 303 EDLLRAAQTCRSWRFLAEDNLLWREKCLEAA---TLHRNKKTHVPDLF------------ 347
           +DLL+AAQTCR WR LAEDNLLWREKC E      LH  ++  +   F            
Sbjct: 299 KDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQ 358

Query: 348 ---------------------------GFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLM 380
                                        QF G  +VSGS D +++VW A +G    TL+
Sbjct: 359 HRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLV 418

Query: 381 GHQSLTSGMELRNNILVSGNADSTVKVWD--------------------------IVSGT 414
           GH       ++R+NI++SG+ D T+KVW+                          +VSG+
Sbjct: 419 GHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGS 478

Query: 415 KKLMFRI-------CL--------------FDGVHVVSG--------------------- 432
           +    R+       CL              +DG  VVSG                     
Sbjct: 479 RDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQ 538

Query: 433 -------------------SLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGN 473
                              SLDTSIRVW+ E+GN  HTL GHQSLTSGMEL++NILVSGN
Sbjct: 539 GHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGN 598

Query: 474 ADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFST 533
           ADSTVK+WDI +GQCLQTL G NKHQSAVTCLQFN  FVITSSDDGTVKLWD+KTGEF  
Sbjct: 599 ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEF-- 656

Query: 534 PLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDS 593
                                                              IRNLV+L+S
Sbjct: 657 ---------------------------------------------------IRNLVTLES 665

Query: 594 GGSGGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVDSK 635
           GGSGGVVWRIRAS TKLVCAVGSRNGTEETKLLVLDFDVD K
Sbjct: 666 GGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK 707




Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1.
Homo sapiens (taxid: 9606)
>sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 Back     alignment and function description
>sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 Back     alignment and function description
>sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 Back     alignment and function description
>sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description
>sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1 Back     alignment and function description
>sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=4 SV=1 Back     alignment and function description
>sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query635
282847463701 archipelago [Tribolium castaneum] 0.530 0.480 0.496 1e-118
270012799701 archipelago [Tribolium castaneum] 0.530 0.480 0.496 1e-118
444724173 737 F-box/WD repeat-containing protein 7 [Tu 0.535 0.461 0.479 1e-114
328711450648 PREDICTED: f-box/WD repeat-containing pr 0.535 0.524 0.460 1e-110
417412524 740 Putative cdc4, partial [Desmodus rotundu 0.535 0.459 0.455 1e-108
158294047 1456 AGAP005359-PA [Anopheles gambiae str. PE 0.524 0.228 0.449 1e-108
291401123 842 PREDICTED: F-box and WD repeat domain co 0.535 0.403 0.454 1e-108
440902791706 F-box/WD repeat-containing protein 7 [Bo 0.535 0.481 0.454 1e-108
292609708605 PREDICTED: f-box/WD repeat-containing pr 0.535 0.561 0.459 1e-108
348582428711 PREDICTED: F-box/WD repeat-containing pr 0.535 0.478 0.454 1e-108
>gi|282847463|ref|NP_001164280.1| archipelago [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  434 bits (1115), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 257/518 (49%), Positives = 290/518 (55%), Gaps = 181/518 (34%)

Query: 245 LKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPED 304
            + WSNAERILAI +LI  CEPTQ+RHMMQ+IEPQFQRDFISLLPRELAL VL+FL+P+D
Sbjct: 229 FQKWSNAERILAISELIARCEPTQVRHMMQVIEPQFQRDFISLLPRELALNVLSFLEPKD 288

Query: 305 LLRAAQTCRSWRFLAEDNLLWREKCLEAATLH---------------------------- 336
           LLRAAQTCRSWRFLAEDNLLW+EKC +A                                
Sbjct: 289 LLRAAQTCRSWRFLAEDNLLWKEKCRQAGIDEIPKRRCSPRSPGTQMSPWKAAYMRQHAI 348

Query: 337 ----RNKKTHVPDLFG---------FQFDGVHVVSGSLDTSIR----------------- 366
               R+K    P +            QF G  +VSGS D +++                 
Sbjct: 349 EMNWRSKPIRPPKMLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAITGKCLRTLVGHT 408

Query: 367 -----------------------VWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADS 403
                                  VW+AE+G+  HTL GH S    M L  N +VSG+ D+
Sbjct: 409 GGVWSSQMSGATIISGSTDRTLKVWDAETGDCIHTLNGHTSTVRCMHLHGNKVVSGSRDA 468

Query: 404 TVKVWDI--------------------------VSGTKKLMFRI-------CL------- 423
           T++VWDI                          VSG    M ++       CL       
Sbjct: 469 TLRVWDIKTGACLHVLVGHLAAVRCVQYDGRLVVSGAYDYMVKVWNPEREECLHTLQGHT 528

Query: 424 -------FDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADS 476
                  FDGVHVVSGSLDTSIRVWE E+G  +HTLMGHQSLTSGMELRNNILVSGNADS
Sbjct: 529 NRVYSLQFDGVHVVSGSLDTSIRVWEVETGACKHTLMGHQSLTSGMELRNNILVSGNADS 588

Query: 477 TVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLM 536
           TVKVWDIV+GQCLQTLSG  KHQSAVTCLQFN+RFVITSSDDGTVKLWDV+TGEF     
Sbjct: 589 TVKVWDIVTGQCLQTLSGPYKHQSAVTCLQFNNRFVITSSDDGTVKLWDVRTGEF----- 643

Query: 537 SSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGS 596
                                                           IRNLV+LDSGGS
Sbjct: 644 ------------------------------------------------IRNLVALDSGGS 655

Query: 597 GGVVWRIRASETKLVCAVGSRNGTEETKLLVLDFDVDS 634
           GGVVWRIRA++TKLVCAVGSRNGTEETKLLVLDFDVDS
Sbjct: 656 GGVVWRIRANDTKLVCAVGSRNGTEETKLLVLDFDVDS 693




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270012799|gb|EFA09247.1| archipelago [Tribolium castaneum] Back     alignment and taxonomy information
>gi|444724173|gb|ELW64787.1| F-box/WD repeat-containing protein 7 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|328711450|ref|XP_003244541.1| PREDICTED: f-box/WD repeat-containing protein 7-like isoform 2 [Acyrthosiphon pisum] gi|328711452|ref|XP_001950576.2| PREDICTED: f-box/WD repeat-containing protein 7-like isoform 1 [Acyrthosiphon pisum] gi|328711454|ref|XP_003244542.1| PREDICTED: f-box/WD repeat-containing protein 7-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|417412524|gb|JAA52641.1| Putative cdc4, partial [Desmodus rotundus] Back     alignment and taxonomy information
>gi|158294047|ref|XP_315369.4| AGAP005359-PA [Anopheles gambiae str. PEST] gi|157015383|gb|EAA11813.4| AGAP005359-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|291401123|ref|XP_002716951.1| PREDICTED: F-box and WD repeat domain containing 7 [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|440902791|gb|ELR53534.1| F-box/WD repeat-containing protein 7 [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|292609708|ref|XP_693393.4| PREDICTED: f-box/WD repeat-containing protein 7 [Danio rerio] Back     alignment and taxonomy information
>gi|348582428|ref|XP_003476978.1| PREDICTED: F-box/WD repeat-containing protein 7 isoform 1 [Cavia porcellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query635
UNIPROTKB|F1MNN4627 FBXW7 "Uncharacterized protein 0.508 0.515 0.435 6.5e-67
UNIPROTKB|E2QUZ3712 FBXW7 "Uncharacterized protein 0.508 0.453 0.435 6.5e-67
UNIPROTKB|Q969H0707 FBXW7 "F-box/WD repeat-contain 0.508 0.456 0.435 6.5e-67
UNIPROTKB|F1N9W1587 FBXW7 "Uncharacterized protein 0.508 0.550 0.435 8.2e-67
MGI|MGI:1354695629 Fbxw7 "F-box and WD-40 domain 0.508 0.513 0.435 8.2e-67
ZFIN|ZDB-GENE-090313-79760 fbxw7 "F-box and WD repeat dom 0.508 0.425 0.435 8.2e-67
FB|FBgn00411711326 ago "archipelago" [Drosophila 0.494 0.236 0.397 8e-60
RGD|2321145588 Fbxw7 "F-box and WD repeat dom 0.508 0.549 0.435 1.1e-66
WB|WBGene00004767587 sel-10 [Caenorhabditis elegans 0.466 0.504 0.344 3.1e-44
UNIPROTKB|Q93794587 sel-10 "F-box/WD repeat-contai 0.466 0.504 0.344 3.1e-44
UNIPROTKB|F1MNN4 FBXW7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 680 (244.4 bits), Expect = 6.5e-67, P = 6.5e-67
 Identities = 155/356 (43%), Positives = 219/356 (61%)

Query:   243 RTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQP 302
             +  + WS  E++LA+ +LIDSCEPTQ++HMMQ+IEPQFQRDFISLLP+ELALYVL+FL+P
Sbjct:   159 KMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEP 218

Query:   303 EDLLRAAQTCRSWRFLAEDNLLWREKCLEAAT---LH-RNKKTHVPDLFGFQFDGVHVVS 358
             +DLL+AAQTCR WR LAEDNLLWREKC E      LH + +K   P      +   ++  
Sbjct:   219 KDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQ 278

Query:   359 GSLDTSIRVWEAESGNLRHTLMGHQS-LTSGMELRNNILVSGNADSTVKVWDIVSGTKKL 417
               +DT+ R  E +S  +   L GH   + + ++   N +VSG+ D+T+KVW  V+G K L
Sbjct:   279 HRIDTNWRRGELKSPKV---LKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTG-KCL 334

Query:   418 MFRICLFDGVH--------VVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNIL 469
                +    GV         ++SGS D +++VW AE+G   HTL GH S    M L    +
Sbjct:   335 RTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRV 394

Query:   470 VSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTG 529
             VSG+ D+T++VWDI +GQCL  L G   H +AV C+Q++ R V++ + D  VK+WD +T 
Sbjct:   395 VSGSRDATLRVWDIETGQCLHVLMG---HVAAVRCVQYDGRRVVSGAYDFMVKVWDPET- 450

Query:   530 EFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFI 585
                T L +   L      +YS       LQF+   V++ S D ++++WDV+TG  I
Sbjct:   451 --ETCLHT---LQGHTNRVYS-------LQFDGIHVVSGSLDTSIRVWDVETGNCI 494


GO:2000060 "positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0070374 "positive regulation of ERK1 and ERK2 cascade" evidence=IEA
GO:0050821 "protein stabilization" evidence=IEA
GO:0045741 "positive regulation of epidermal growth factor-activated receptor activity" evidence=IEA
GO:0034644 "cellular response to UV" evidence=IEA
GO:0032876 "negative regulation of DNA endoreduplication" evidence=IEA
GO:0031146 "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0030324 "lung development" evidence=IEA
GO:0019005 "SCF ubiquitin ligase complex" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA
GO:0007219 "Notch signaling pathway" evidence=IEA
GO:0007062 "sister chromatid cohesion" evidence=IEA
GO:0006974 "response to DNA damage stimulus" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0001570 "vasculogenesis" evidence=IEA
UNIPROTKB|E2QUZ3 FBXW7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q969H0 FBXW7 "F-box/WD repeat-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9W1 FBXW7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1354695 Fbxw7 "F-box and WD-40 domain protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-79 fbxw7 "F-box and WD repeat domain containing 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0041171 ago "archipelago" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2321145 Fbxw7 "F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00004767 sel-10 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q93794 sel-10 "F-box/WD repeat-containing protein sel-10" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query635
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-40
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-38
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-37
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-36
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-36
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-34
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-33
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-20
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-20
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-19
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-17
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-17
pfam1293747 pfam12937, F-box-like, F-box-like 7e-14
pfam0064648 pfam00646, F-box, F-box domain 4e-07
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-06
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 2e-05
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 2e-05
smart0032040 smart00320, WD40, WD40 repeats 3e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-04
smart0032040 smart00320, WD40, WD40 repeats 2e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-04
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 3e-04
smart0032040 smart00320, WD40, WD40 repeats 0.001
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  147 bits (374), Expect = 5e-40
 Identities = 80/261 (30%), Positives = 120/261 (45%), Gaps = 46/261 (17%)

Query: 19  KVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKG 78
           + LKGH    +TC+ FS    P    + + S    + +        W     +  + LKG
Sbjct: 3   RTLKGHTG-GVTCVAFS----PDGKLLATGSGDGTIKV--------WDLETGELLRTLKG 49

Query: 79  HDDHVITCLQFS-GSRIVSGSDDNTLKVWSATTGKC---------------------LLV 116
           H   V      + G+ + SGS D T+++W   TG+C                     +L 
Sbjct: 50  HTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILS 109

Query: 117 SGSRDATLRVWHIESGECLHVLVGHLAAVRCVQY--DGKLVVSGAYDYMVKIWNPDTEEC 174
           S SRD T++VW +E+G+CL  L GH   V  V +  DG  V S + D  +K+W+  T +C
Sbjct: 110 SSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKC 169

Query: 175 LHAELQETE----VELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQ 230
           +      T     V  S       +++S S D T+K+W  +TGKCL TL GH  GV S  
Sbjct: 170 VATLTGHTGEVNSVAFSPD---GEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVA 226

Query: 231 MA--GNIIISGSTDRTLKGWS 249
            +  G ++ SGS D T++ W 
Sbjct: 227 FSPDGYLLASGSEDGTIRVWD 247


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 635
KOG0319|consensus 775 100.0
KOG0319|consensus 775 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0291|consensus 893 100.0
KOG0318|consensus603 100.0
KOG0306|consensus 888 100.0
KOG0318|consensus603 100.0
KOG0306|consensus 888 100.0
KOG1408|consensus 1080 100.0
KOG0291|consensus 893 100.0
KOG1539|consensus 910 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG2106|consensus626 100.0
KOG0272|consensus459 100.0
KOG1408|consensus 1080 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0273|consensus524 100.0
KOG0279|consensus315 100.0
KOG0296|consensus399 100.0
KOG0273|consensus524 100.0
KOG1539|consensus 910 100.0
KOG0281|consensus499 100.0
KOG0281|consensus499 100.0
KOG0296|consensus399 100.0
KOG0295|consensus406 100.0
KOG0315|consensus311 100.0
KOG0276|consensus 794 100.0
KOG0285|consensus460 100.0
KOG0315|consensus311 100.0
KOG0285|consensus460 100.0
KOG0295|consensus406 100.0
KOG1063|consensus764 100.0
KOG0265|consensus338 100.0
KOG0263|consensus707 100.0
KOG1063|consensus764 100.0
KOG0284|consensus464 100.0
KOG2048|consensus 691 100.0
KOG0645|consensus312 100.0
KOG2106|consensus626 100.0
KOG0292|consensus 1202 100.0
KOG0282|consensus503 100.0
KOG0645|consensus312 100.0
KOG0276|consensus 794 100.0
KOG0316|consensus307 100.0
KOG0292|consensus 1202 100.0
KOG0263|consensus707 100.0
KOG0274|consensus537 100.0
KOG0265|consensus338 100.0
KOG0293|consensus519 100.0
KOG0316|consensus307 100.0
KOG0274|consensus537 100.0
KOG0284|consensus464 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0266|consensus456 100.0
KOG0282|consensus503 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0313|consensus423 100.0
KOG0266|consensus456 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0293|consensus519 99.98
KOG0313|consensus423 99.98
KOG0278|consensus334 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG1407|consensus313 99.97
KOG0643|consensus327 99.97
KOG0278|consensus334 99.97
KOG0299|consensus479 99.97
KOG0275|consensus508 99.97
KOG0288|consensus459 99.96
KOG2048|consensus691 99.96
KOG0275|consensus508 99.96
KOG1446|consensus311 99.96
KOG0294|consensus362 99.96
KOG0301|consensus 745 99.96
KOG0310|consensus 487 99.96
KOG0277|consensus311 99.96
KOG0643|consensus327 99.96
KOG1445|consensus 1012 99.96
KOG0300|consensus481 99.96
KOG1407|consensus313 99.96
KOG0277|consensus311 99.96
KOG0646|consensus 476 99.96
KOG0305|consensus484 99.96
KOG0308|consensus 735 99.96
KOG0288|consensus459 99.96
KOG1446|consensus311 99.96
KOG0301|consensus 745 99.96
KOG1036|consensus323 99.95
KOG0294|consensus362 99.95
KOG0300|consensus481 99.95
KOG0283|consensus712 99.95
KOG0283|consensus712 99.95
KOG0299|consensus479 99.95
KOG0289|consensus506 99.95
KOG0641|consensus350 99.95
PTZ00421493 coronin; Provisional 99.95
KOG0772|consensus 641 99.95
KOG0973|consensus 942 99.95
KOG0310|consensus 487 99.94
KOG0641|consensus350 99.94
KOG0308|consensus 735 99.94
KOG0640|consensus430 99.94
PTZ00421 493 coronin; Provisional 99.94
KOG0268|consensus433 99.94
KOG0268|consensus433 99.94
KOG0647|consensus347 99.94
PTZ00420 568 coronin; Provisional 99.94
KOG0973|consensus 942 99.94
KOG0647|consensus347 99.94
KOG0640|consensus430 99.94
KOG4283|consensus397 99.94
KOG2096|consensus420 99.94
KOG0305|consensus484 99.94
KOG0772|consensus641 99.93
KOG0289|consensus506 99.93
KOG0646|consensus476 99.93
KOG1036|consensus323 99.93
PTZ00420 568 coronin; Provisional 99.93
KOG1332|consensus299 99.93
KOG2055|consensus514 99.92
KOG1445|consensus 1012 99.92
KOG1332|consensus299 99.92
KOG1963|consensus 792 99.91
KOG2096|consensus420 99.91
KOG2445|consensus361 99.91
KOG1274|consensus 933 99.91
KOG4283|consensus397 99.91
KOG0639|consensus705 99.91
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG1538|consensus 1081 99.9
KOG0264|consensus422 99.9
KOG0267|consensus 825 99.89
KOG0264|consensus422 99.89
KOG0321|consensus 720 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG0639|consensus705 99.88
KOG2055|consensus514 99.88
KOG1274|consensus 933 99.88
KOG0650|consensus733 99.88
KOG4378|consensus 673 99.88
KOG1273|consensus405 99.88
KOG2445|consensus361 99.88
KOG0321|consensus 720 99.87
KOG1273|consensus405 99.86
KOG4378|consensus 673 99.86
KOG0650|consensus733 99.86
KOG1034|consensus385 99.85
KOG0269|consensus 839 99.85
KOG1034|consensus385 99.85
KOG0270|consensus463 99.85
KOG4328|consensus498 99.85
KOG0269|consensus 839 99.85
KOG0649|consensus325 99.84
KOG0649|consensus325 99.84
KOG0267|consensus 825 99.84
KOG0302|consensus440 99.84
KOG2110|consensus 391 99.84
KOG4328|consensus498 99.83
KOG0270|consensus463 99.82
COG2319466 FOG: WD40 repeat [General function prediction only 99.82
KOG1963|consensus 792 99.82
KOG0322|consensus323 99.82
COG2319466 FOG: WD40 repeat [General function prediction only 99.82
KOG2919|consensus406 99.82
KOG1517|consensus1387 99.81
KOG0302|consensus440 99.81
KOG0322|consensus323 99.81
KOG1188|consensus376 99.8
KOG1009|consensus434 99.8
KOG1538|consensus 1081 99.8
KOG2919|consensus406 99.78
KOG1310|consensus 758 99.78
KOG1188|consensus376 99.78
KOG4227|consensus609 99.77
KOG1517|consensus1387 99.76
KOG0307|consensus 1049 99.76
KOG0642|consensus577 99.76
KOG1524|consensus 737 99.75
KOG1912|consensus 1062 99.74
KOG1009|consensus434 99.74
KOG0642|consensus577 99.74
KOG0644|consensus 1113 99.74
KOG0307|consensus 1049 99.74
KOG2111|consensus346 99.74
KOG1240|consensus1431 99.74
KOG1334|consensus559 99.72
KOG0974|consensus 967 99.71
KOG0644|consensus 1113 99.71
KOG0303|consensus472 99.7
KOG1310|consensus 758 99.69
KOG0771|consensus398 99.68
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.67
KOG1007|consensus370 99.67
KOG1587|consensus555 99.67
KOG0290|consensus364 99.66
KOG1524|consensus 737 99.66
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.66
KOG0303|consensus 472 99.66
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.65
KOG1587|consensus555 99.65
KOG4227|consensus 609 99.64
PRK11028330 6-phosphogluconolactonase; Provisional 99.64
KOG2111|consensus346 99.63
KOG1334|consensus559 99.62
KOG1272|consensus 545 99.62
KOG1007|consensus370 99.61
KOG2110|consensus391 99.61
KOG0290|consensus364 99.61
KOG2321|consensus 703 99.6
KOG1240|consensus1431 99.59
KOG4497|consensus447 99.58
KOG2394|consensus 636 99.58
KOG0771|consensus398 99.58
KOG3881|consensus412 99.58
KOG1912|consensus 1062 99.58
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.57
PRK11028330 6-phosphogluconolactonase; Provisional 99.55
KOG0974|consensus 967 99.55
KOG3881|consensus412 99.54
KOG2041|consensus 1189 99.54
KOG4497|consensus447 99.51
KOG2394|consensus636 99.51
KOG1409|consensus404 99.49
PRK01742429 tolB translocation protein TolB; Provisional 99.48
KOG1523|consensus361 99.47
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.47
PRK01742429 tolB translocation protein TolB; Provisional 99.46
KOG1523|consensus 361 99.46
KOG1272|consensus545 99.46
KOG4547|consensus 541 99.45
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.44
KOG1409|consensus404 99.4
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.39
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.38
KOG2139|consensus 445 99.38
KOG2321|consensus 703 99.36
KOG2041|consensus 1189 99.36
KOG4547|consensus 541 99.33
KOG2139|consensus445 99.32
PRK05137435 tolB translocation protein TolB; Provisional 99.31
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.3
PRK03629429 tolB translocation protein TolB; Provisional 99.3
KOG2315|consensus 566 99.29
PRK03629429 tolB translocation protein TolB; Provisional 99.27
PRK04922433 tolB translocation protein TolB; Provisional 99.26
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.26
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.26
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.25
KOG0280|consensus339 99.24
PRK02889427 tolB translocation protein TolB; Provisional 99.22
KOG1354|consensus433 99.21
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.21
PRK04922433 tolB translocation protein TolB; Provisional 99.2
PRK02889427 tolB translocation protein TolB; Provisional 99.19
KOG2315|consensus566 99.17
COG4946 668 Uncharacterized protein related to the periplasmic 99.15
PRK05137435 tolB translocation protein TolB; Provisional 99.14
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.14
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.14
KOG1354|consensus433 99.12
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.11
KOG2314|consensus 698 99.09
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.09
KOG4190|consensus1034 99.08
KOG4532|consensus344 99.07
KOG0280|consensus339 99.07
KOG0309|consensus 1081 99.04
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 99.04
KOG1275|consensus 1118 99.03
KOG4190|consensus1034 99.01
KOG1064|consensus2439 99.01
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.0
KOG4649|consensus354 98.99
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.99
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.98
PRK00178430 tolB translocation protein TolB; Provisional 98.96
KOG0882|consensus558 98.95
PRK04792448 tolB translocation protein TolB; Provisional 98.95
KOG4649|consensus354 98.95
KOG1064|consensus2439 98.95
KOG2695|consensus425 98.94
KOG0309|consensus 1081 98.93
PRK00178430 tolB translocation protein TolB; Provisional 98.88
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.87
KOG2314|consensus698 98.87
PRK01029428 tolB translocation protein TolB; Provisional 98.83
PRK01029428 tolB translocation protein TolB; Provisional 98.83
KOG3914|consensus390 98.81
PRK04792448 tolB translocation protein TolB; Provisional 98.8
KOG4714|consensus319 98.77
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.76
KOG3914|consensus 390 98.76
COG4946 668 Uncharacterized protein related to the periplasmic 98.73
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.72
KOG1275|consensus 1118 98.7
PRK04043419 tolB translocation protein TolB; Provisional 98.69
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.67
KOG4714|consensus319 98.65
KOG4532|consensus344 98.64
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.64
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.6
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.6
KOG2695|consensus425 98.57
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.57
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.56
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.55
KOG0882|consensus 558 98.54
KOG2066|consensus 846 98.52
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.51
KOG1645|consensus463 98.37
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.35
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 98.28
KOG2066|consensus 846 98.27
KOG1645|consensus463 98.27
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.25
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.24
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.2
PRK02888 635 nitrous-oxide reductase; Validated 98.19
PRK04043419 tolB translocation protein TolB; Provisional 98.18
KOG3621|consensus 726 98.18
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.15
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.14
KOG2114|consensus 933 98.13
KOG2114|consensus 933 98.12
PRK02888 635 nitrous-oxide reductase; Validated 98.08
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.0
KOG3617|consensus 1416 97.99
KOG3621|consensus 726 97.99
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.95
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.94
KOG1920|consensus 1265 97.92
KOG1832|consensus1516 97.91
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.87
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.86
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.84
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.75
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.73
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.73
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.72
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.71
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.7
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.67
KOG1832|consensus 1516 97.66
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.64
KOG4441|consensus571 97.6
KOG1008|consensus 783 97.55
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.48
KOG1920|consensus 1265 97.45
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.41
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.37
PHA02713557 hypothetical protein; Provisional 97.36
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.31
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.31
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.29
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.28
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.28
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.27
KOG1897|consensus 1096 97.26
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.24
KOG4441|consensus571 97.22
KOG3617|consensus 1416 97.15
KOG2079|consensus 1206 97.15
PHA02713557 hypothetical protein; Provisional 97.14
KOG2444|consensus238 97.1
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.08
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.08
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.03
KOG4640|consensus 665 96.96
KOG4640|consensus 665 96.92
PHA03098534 kelch-like protein; Provisional 96.92
KOG4499|consensus310 96.87
KOG4499|consensus310 96.87
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.85
KOG2444|consensus238 96.85
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.84
KOG2395|consensus644 96.71
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.63
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.56
KOG2079|consensus 1206 96.55
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 96.51
KOG1008|consensus 783 96.5
COG5276370 Uncharacterized conserved protein [Function unknow 96.45
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.4
COG3823262 Glutamine cyclotransferase [Posttranslational modi 96.36
PHA02790480 Kelch-like protein; Provisional 96.27
PHA03098534 kelch-like protein; Provisional 96.05
COG5276370 Uncharacterized conserved protein [Function unknow 96.05
KOG2395|consensus 644 96.02
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.9
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 95.9
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.86
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.84
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 95.78
KOG1897|consensus1096 95.76
PHA02790480 Kelch-like protein; Provisional 95.7
COG3391381 Uncharacterized conserved protein [Function unknow 95.63
COG3823262 Glutamine cyclotransferase [Posttranslational modi 95.62
PRK13616591 lipoprotein LpqB; Provisional 95.45
PRK13616591 lipoprotein LpqB; Provisional 95.35
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.3
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.23
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 95.17
PLN02153341 epithiospecifier protein 94.74
COG3391381 Uncharacterized conserved protein [Function unknow 94.73
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.68
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 94.16
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 94.16
PLN02193470 nitrile-specifier protein 94.09
PF02333 381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 93.81
PF10647 253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.71
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.68
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 93.68
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.51
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 93.49
PF09826 521 Beta_propel: Beta propeller domain; InterPro: IPR0 93.36
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 93.19
KOG1916|consensus 1283 93.14
KOG2280|consensus 829 92.99
COG1520370 FOG: WD40-like repeat [Function unknown] 92.96
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.63
PLN02193470 nitrile-specifier protein 92.55
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.55
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.42
KOG2280|consensus 829 92.41
COG5167776 VID27 Protein involved in vacuole import and degra 92.35
PLN02153341 epithiospecifier protein 92.34
COG1520370 FOG: WD40-like repeat [Function unknown] 92.01
KOG1896|consensus1366 91.79
KOG3630|consensus 1405 91.73
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 91.72
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 91.69
COG5167776 VID27 Protein involved in vacuole import and degra 91.56
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.29
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 91.23
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 91.11
PF14727418 PHTB1_N: PTHB1 N-terminus 91.07
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 90.78
COG3204316 Uncharacterized protein conserved in bacteria [Fun 90.53
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.39
PF13449 326 Phytase-like: Esterase-like activity of phytase 89.97
COG3386307 Gluconolactonase [Carbohydrate transport and metab 89.7
KOG2377|consensus 657 89.59
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 89.47
KOG1900|consensus 1311 89.46
COG3490366 Uncharacterized protein conserved in bacteria [Fun 89.19
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 88.87
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 88.78
KOG1916|consensus 1283 88.51
PF13449326 Phytase-like: Esterase-like activity of phytase 88.5
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 88.42
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 87.9
KOG2247|consensus 615 87.62
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 87.6
PF08801 422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 86.17
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 85.93
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 85.72
KOG4460|consensus 741 85.64
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 85.49
COG3292 671 Predicted periplasmic ligand-binding sensor domain 85.28
KOG2247|consensus 615 85.12
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 84.5
KOG1900|consensus 1311 84.49
COG3292 671 Predicted periplasmic ligand-binding sensor domain 84.2
KOG1983|consensus 993 84.06
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 83.25
KOG0379|consensus 482 83.11
KOG3630|consensus 1405 82.33
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 82.21
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 81.99
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 81.92
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 81.42
PRK10115 686 protease 2; Provisional 81.13
KOG3616|consensus 1636 80.23
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 80.13
>KOG0319|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-55  Score=406.13  Aligned_cols=503  Identities=21%  Similarity=0.365  Sum_probs=407.0

Q ss_pred             eeeeecCCCCC-Ccccc-ccccceEEEEEecCCCCCCCceeecCCcchheeeccceeeeeeecCCCCCCceeec-cCcce
Q psy18018          7 EINWRTRPIKD-PKVLK-GHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKG-HDDHV   83 (635)
Q Consensus         7 ~~~~~~~~~~~-~~~l~-gh~~~vi~~~~~s~~~~~~~~~la~~~~~~~~~~~~~~~~~iwd~~~~~~~~~l~~-h~~~v   83 (635)
                      +.+.++.+... .+... +-.+.+ ++++++    ||+++|.++...+.+.        +|+.++++.++.++. |++++
T Consensus        42 Vi~idv~t~~~~l~s~~~ed~d~i-ta~~l~----~d~~~L~~a~rs~llr--------v~~L~tgk~irswKa~He~Pv  108 (775)
T KOG0319|consen   42 VIIIDVATGSIALPSGSNEDEDEI-TALALT----PDEEVLVTASRSQLLR--------VWSLPTGKLIRSWKAIHEAPV  108 (775)
T ss_pred             EEEEEccCCceecccCCccchhhh-heeeec----CCccEEEEeeccceEE--------EEEcccchHhHhHhhccCCCe
Confidence            33445454444 33333 444555 999999    8999999998766655        699999999999998 99998


Q ss_pred             EEEEEEc--CCEEEEeeCCCcEEEEECCCCcEE-----------------------EEEeeCCCcEEEEeCCCCeE-EEE
Q psy18018         84 ITCLQFS--GSRIVSGSDDNTLKVWSATTGKCL-----------------------LVSGSRDATLRVWHIESGEC-LHV  137 (635)
Q Consensus        84 i~~~~~s--~~~l~s~~~d~~v~vWd~~~~~~l-----------------------l~~~~~dg~i~vwd~~~~~~-~~~  137 (635)
                       .-++|+  +.+||+|+.|+.|+|||+..+.+.                       |++|..|+.+++||+.+... +..
T Consensus       109 -i~ma~~~~g~LlAtggaD~~v~VWdi~~~~~th~fkG~gGvVssl~F~~~~~~~lL~sg~~D~~v~vwnl~~~~tcl~~  187 (775)
T KOG0319|consen  109 -ITMAFDPTGTLLATGGADGRVKVWDIKNGYCTHSFKGHGGVVSSLLFHPHWNRWLLASGATDGTVRVWNLNDKRTCLHT  187 (775)
T ss_pred             -EEEEEcCCCceEEeccccceEEEEEeeCCEEEEEecCCCceEEEEEeCCccchhheeecCCCceEEEEEcccCchHHHH
Confidence             689999  889999999999999999987764                       89999999999999996654 788


Q ss_pred             eeCCCcceEEEEe--cCCEEEEEeCCCeEEEEeCCCccceeeccccceeEEeeeccC-----CCEEEEEeCCCcEEEEEC
Q psy18018        138 LVGHLAAVRCVQY--DGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYAL-----RSRIVSGSDDNTLKVWSA  210 (635)
Q Consensus       138 l~~h~~~v~~l~~--~~~~l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~-----~~~l~~~~~dg~i~vwd~  210 (635)
                      +..|.+.|++++|  |+..+++++.|..+.+||+...+.....+.............     +.++++++.+|.+++||.
T Consensus       188 ~~~H~S~vtsL~~~~d~~~~ls~~RDkvi~vwd~~~~~~l~~lp~ye~~E~vv~l~~~~~~~~~~~~TaG~~g~~~~~d~  267 (775)
T KOG0319|consen  188 MILHKSAVTSLAFSEDSLELLSVGRDKVIIVWDLVQYKKLKTLPLYESLESVVRLREELGGKGEYIITAGGSGVVQYWDS  267 (775)
T ss_pred             HHhhhhheeeeeeccCCceEEEeccCcEEEEeehhhhhhhheechhhheeeEEEechhcCCcceEEEEecCCceEEEEec
Confidence            8999999999999  999999999999999999988777766655555544444444     568999999999999999


Q ss_pred             CCCeEEEEEeCC-CCCeEEEEe--eCCEEEEeeCceeEEEecccceeeeccccccccCccceeeeeeeeccccccceeec
Q psy18018        211 TTGKCLRTLIGH-TGGVWSSQM--AGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISL  287 (635)
Q Consensus       211 ~~~~~~~~~~~h-~~~v~~~~~--~~~~l~s~~~dg~i~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  287 (635)
                      ++++++...... ...+..+..  ....++....|..+.++|.++.......                            
T Consensus       268 es~~~~~~~~~~~~~e~~~~~~~~~~~~~l~vtaeQnl~l~d~~~l~i~k~i----------------------------  319 (775)
T KOG0319|consen  268 ESGKCVYKQRQSDSEEIDHLLAIESMSQLLLVTAEQNLFLYDEDELTIVKQI----------------------------  319 (775)
T ss_pred             ccchhhhhhccCCchhhhcceeccccCceEEEEccceEEEEEccccEEehhh----------------------------
Confidence            999888665433 222443333  3567778888899999976654321100                            


Q ss_pred             cccceeeEEEeecCchhhHhhcccccceeEeecCCcchhhhhhhhhhhccccccCCCceEEEEecCcEEEEecCCCeEEE
Q psy18018        288 LPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRV  367 (635)
Q Consensus       288 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~l~~~~~dg~i~v  367 (635)
                                                                       .........+.-+.|+.++++++++.+.+++
T Consensus       320 -------------------------------------------------vG~ndEI~Dm~~lG~e~~~laVATNs~~lr~  350 (775)
T KOG0319|consen  320 -------------------------------------------------VGYNDEILDMKFLGPEESHLAVATNSPELRL  350 (775)
T ss_pred             -------------------------------------------------cCCchhheeeeecCCccceEEEEeCCCceEE
Confidence                                                             0111111122225667899999999999999


Q ss_pred             EEccCCceEEeeeCCCcceeEEE-Ee-CCEEEEEeCCCcEEEEEccCCccee--------------EEEEEeeCCcEEEE
Q psy18018        368 WEAESGNLRHTLMGHQSLTSGME-LR-NNILVSGNADSTVKVWDIVSGTKKL--------------MFRICLFDGVHVVS  431 (635)
Q Consensus       368 ~~~~~~~~~~~~~~~~~~v~~l~-~~-~~~l~s~~~dg~i~iwd~~~~~~~~--------------~~~~~~~~~~~l~~  431 (635)
                      |+..+..+. .+.+|+..|.++. ++ +.+|++++.|.++++|.++++....              ..........++++
T Consensus       351 y~~~~~~c~-ii~GH~e~vlSL~~~~~g~llat~sKD~svilWr~~~~~~~~~~~a~~~gH~~svgava~~~~~asffvs  429 (775)
T KOG0319|consen  351 YTLPTSYCQ-IIPGHTEAVLSLDVWSSGDLLATGSKDKSVILWRLNNNCSKSLCVAQANGHTNSVGAVAGSKLGASFFVS  429 (775)
T ss_pred             EecCCCceE-EEeCchhheeeeeecccCcEEEEecCCceEEEEEecCCcchhhhhhhhcccccccceeeecccCccEEEE
Confidence            998877665 8899999999999 44 6699999999999999885442211              11112234568999


Q ss_pred             EeCCCcEEEEeCCCCce---------eeeeccCCccEEEEEec--CCEEEEEeCCCcEEEEECCCCceeEEecCCCcccc
Q psy18018        432 GSLDTSIRVWEAESGNL---------RHTLMGHQSLTSGMELR--NNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQS  500 (635)
Q Consensus       432 ~~~d~~i~~~d~~~~~~---------~~~~~~~~~~v~~~~~~--~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~  500 (635)
                      ++.|.++++|++...+.         ..+...|...|++++..  ..++++|+.|++.+||+++..+....+.+   |..
T Consensus       430 vS~D~tlK~W~l~~s~~~~~~~~~~~~~t~~aHdKdIN~Vaia~ndkLiAT~SqDktaKiW~le~~~l~~vLsG---H~R  506 (775)
T KOG0319|consen  430 VSQDCTLKLWDLPKSKETAFPIVLTCRYTERAHDKDINCVAIAPNDKLIATGSQDKTAKIWDLEQLRLLGVLSG---HTR  506 (775)
T ss_pred             ecCCceEEEecCCCcccccccceehhhHHHHhhcccccceEecCCCceEEecccccceeeecccCceEEEEeeC---Ccc
Confidence            99999999999976211         11335699999998875  45999999999999999999999999998   999


Q ss_pred             cEEEEEe--cCCEEEEEeCCCcEEEEECCCCceeeeeccceecCceeEEeccCceecccccCCCeEEEEecCCCeEEEEe
Q psy18018        501 AVTCLQF--NSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWD  578 (635)
Q Consensus       501 ~v~~~~~--~~~~l~~~~~d~~i~vwd~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~d~~v~iwd  578 (635)
                      .|.|+.|  +.+.++|+|.|++|+||.+.+..+++++.+           |...|..+.|-.+++.|++++.||.+++|+
T Consensus       507 Gvw~V~Fs~~dq~laT~SgD~TvKIW~is~fSClkT~eG-----------H~~aVlra~F~~~~~qliS~~adGliKlWn  575 (775)
T KOG0319|consen  507 GVWCVSFSKNDQLLATCSGDKTVKIWSISTFSCLKTFEG-----------HTSAVLRASFIRNGKQLISAGADGLIKLWN  575 (775)
T ss_pred             ceEEEEeccccceeEeccCCceEEEEEeccceeeeeecC-----------ccceeEeeeeeeCCcEEEeccCCCcEEEEe
Confidence            9999999  467999999999999999999999999987           688999999999999999999999999999


Q ss_pred             CCCCceEEeeeeccCCCCCceEEEEEeCCCCeEEEEccCCCe
Q psy18018        579 VKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGT  620 (635)
Q Consensus       579 ~~~~~~~~~~~~~~~~~~~~~i~~l~~s~d~~~l~~~~~dg~  620 (635)
                      ++++++++++     ..|.+.||+++-+|.+.++++|+.||.
T Consensus       576 ikt~eC~~tl-----D~H~DrvWaL~~~~~~~~~~tgg~Dg~  612 (775)
T KOG0319|consen  576 IKTNECEMTL-----DAHNDRVWALSVSPLLDMFVTGGGDGR  612 (775)
T ss_pred             ccchhhhhhh-----hhccceeEEEeecCccceeEecCCCeE
Confidence            9999999999     799999999999999999999999997



>KOG0319|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF09826 Beta_propel: Beta propeller domain; InterPro: IPR019198 This entry consists of predicted secreted proteins containing a C-terminal beta-propeller domain distantly related to WD-40 repeats Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query635
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 9e-91
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 4e-32
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 3e-31
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 6e-23
2gnq_A336 Structure Of Wdr5 Length = 336 7e-23
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 7e-23
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 8e-23
2g99_A308 Structural Basis For The Specific Recognition Of Me 9e-23
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-22
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-22
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-22
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-22
2h9l_A329 Wdr5delta23 Length = 329 1e-22
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-22
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-22
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-22
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-22
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-22
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-22
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 7e-22
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-21
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 2e-21
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 2e-10
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 3e-21
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 6e-21
3mks_B 464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-10
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 5e-19
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 1e-17
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-13
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-16
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 4e-16
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 5e-16
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-09
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-14
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-11
3zey_7318 High-resolution Cryo-electron Microscopy Structure 3e-13
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 3e-13
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 1e-08
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 3e-13
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 1e-08
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 6e-13
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 2e-08
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 9e-13
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 2e-08
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-12
1trj_A 314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 7e-04
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-12
3jyv_R 313 Structure Of The 40s Rrna And Proteins And PE TRNA 8e-04
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 1e-12
3izb_a 319 Localization Of The Small Subunit Ribosomal Protein 8e-04
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-12
3rfg_A 319 Crystal Structure Of The Yeast Rack1 Dimer In Space 8e-04
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-12
3rfh_A 319 Crystal Structure Of The Yeast Rack1 Dimer In Space 8e-04
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 2e-12
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 8e-12
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 4e-06
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 1e-11
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 7e-10
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-10
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-10
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 1e-10
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 3e-10
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-10
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-09
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-09
2zkq_a 317 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-04
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 4e-09
4aow_A 340 Crystal Structure Of The Human Rack1 Protein At A R 4e-04
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 1e-08
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 6e-08
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 4e-04
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 1e-07
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 7e-07
3zwl_B369 Structure Of Eukaryotic Translation Initiation Fact 1e-05
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-05
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 3e-05
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 6e-05
1r5m_A425 Crystal Structure Of The C-Terminal Wd40 Domain Of 6e-05
4ggd_A 431 Structural Analysis Of Human Cdc20 Supports Multisi 1e-04
4gga_A 420 Structural Analysis Of Human Cdc20 Supports Multi-S 1e-04
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 1e-04
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 2e-04
3mmy_A 368 Structural And Functional Analysis Of The Interacti 2e-04
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 3e-04
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 3e-04
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 3e-04
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-04
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 5e-04
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 6e-04
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 6e-04
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure

Iteration: 1

Score = 331 bits (848), Expect = 9e-91, Method: Compositional matrix adjust. Identities = 212/498 (42%), Positives = 255/498 (51%), Gaps = 182/498 (36%) Query: 267 TQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRAAQTCRSWRFLAEDNLLWR 326 TQ++HMMQ+IEPQFQRDFISLLP+ELALYVL+FL+P+DLL+AAQTCR WR LAEDNLLWR Sbjct: 1 TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWR 60 Query: 327 EKCLEAAT---LHRNKKTHVPDLF------------------------------------ 347 EKC E LH ++ + F Sbjct: 61 EKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDH 120 Query: 348 ---GFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADST 404 QF G +VSGS D +++VW A +G TL+GH ++R+NI++SG+ D T Sbjct: 121 VITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRT 180 Query: 405 VKVWD--------------------------IVSGTKKLMFRI-------CL-------- 423 +KVW+ +VSG++ R+ CL Sbjct: 181 LKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVA 240 Query: 424 ------FDGVHVVSGS----------------------------------------LDTS 437 +DG VVSG+ LDTS Sbjct: 241 AVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTS 300 Query: 438 IRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVWDIVSGQCLQTLSGRNK 497 IRVW+ E+GN HTL GHQSLTSGMEL++NILVSGNADSTVK+WDI +GQCLQTL G NK Sbjct: 301 IRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNK 360 Query: 498 HQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPFYFLIYSQPLLCPH 557 HQSAVTCLQFN FVITSSDDGTVKLWD+KTGEF L++ Sbjct: 361 HQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVT-------------------- 400 Query: 558 LQFNSRFVITSSDDGTVKLWDVKTGEFIRNXXXXXXXXXXXXXWRIRASETKLVCAVGSR 617 + S G V +W + RAS TKLVCAVGSR Sbjct: 401 --------LESGGSGGV-VWRI------------------------RASNTKLVCAVGSR 427 Query: 618 NGTEETKLLVLDFDVDSK 635 NGTEETKLLVLDFDVD K Sbjct: 428 NGTEETKLLVLDFDVDMK 445
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3ZWL|B Chain B, Structure Of Eukaryotic Translation Initiation Factor Eif3i Complex With Eif3b C-Terminus (655-700) Length = 369 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|1R5M|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Sif2 Length = 425 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query635
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1k32_A 1045 Tricorn protease; protein degradation, substrate g 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.98
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.98
3jrp_A379 Fusion protein of protein transport protein SEC13 99.98
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.92
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.9
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.9
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.87
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.87
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.87
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.86
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.86
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.86
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.85
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.85
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.84
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.84
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.84
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.83
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.83
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.79
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.79
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.79
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.77
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.76
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.76
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.75
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.75
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.75
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.74
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.74
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.73
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.72
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.72
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.71
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.7
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.68
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.67
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.66
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.66
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.66
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.66
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.66
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.65
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.62
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.62
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.61
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.61
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.6
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.6
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.59
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.58
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.58
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.57
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.55
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.55
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.53
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.52
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.52
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.52
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.5
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.5
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.49
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.49
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.48
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.48
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.48
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.47
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.46
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.46
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.46
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.46
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.45
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.44
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.42
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.41
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.41
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.4
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.39
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.39
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.38
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.38
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.34
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.34
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.33
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.32
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.31
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.28
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.28
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.27
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.26
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.23
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.21
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.21
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.21
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.21
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.2
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.19
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.18
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.16
2qe8_A343 Uncharacterized protein; structural genomics, join 99.16
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.16
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.14
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.14
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.13
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.11
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.1
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.09
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.08
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.08
2ece_A462 462AA long hypothetical selenium-binding protein; 99.05
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.03
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.02
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.02
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.01
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.99
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.97
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.96
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.94
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.88
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.87
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.85
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.84
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.83
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.8
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.73
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.71
2qe8_A343 Uncharacterized protein; structural genomics, join 98.7
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.67
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.61
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.6
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.52
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.5
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.47
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.42
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.33
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.31
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.23
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.13
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.04
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.98
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.85
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.85
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.8
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.8
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.78
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.76
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.72
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.67
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.67
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.66
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.64
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.63
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.58
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.56
3ott_A 758 Two-component system sensor histidine kinase; beta 97.53
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.51
3v65_B386 Low-density lipoprotein receptor-related protein; 97.49
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.43
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.42
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.42
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 97.42
3ott_A 758 Two-component system sensor histidine kinase; beta 97.39
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.35
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.33
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.3
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.3
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 97.26
3v65_B386 Low-density lipoprotein receptor-related protein; 97.26
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.23
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.21
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.19
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.19
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.19
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.18
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 97.16
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.14
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.13
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 97.05
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.05
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.01
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.97
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.88
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.87
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.87
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.76
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.76
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.68
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.61
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.56
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.32
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.12
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.11
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.0
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.96
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.93
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.91
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 95.83
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.6
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.33
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.24
3kya_A496 Putative phosphatase; structural genomics, joint c 95.22
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 94.68
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 94.13
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 93.58
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 92.95
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 92.84
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 92.73
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 92.55
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 91.74
4d9s_A406 UVB-resistance protein UVR8; UV resistance, UV-B p 87.79
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 86.65
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 86.25
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 85.46
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 85.28
1tl2_A 236 L10, protein (tachylectin-2); animal lectin, horse 84.09
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 83.22
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 82.05
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 81.72
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 81.66
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
Probab=100.00  E-value=3.4e-63  Score=512.43  Aligned_cols=529  Identities=30%  Similarity=0.473  Sum_probs=427.3

Q ss_pred             CCCccccccccceEEEEEecCCCCCCCceeecCCcchheeeccceeeeeeecCCCCCCceeeccCcceEEEEEEc--CCE
Q psy18018         16 KDPKVLKGHDDHVITCLQFSGKSFPCESFIRSSSPWKALFMSHRSVEINWRTRPIKDPKVLKGHDDHVITCLQFS--GSR   93 (635)
Q Consensus        16 ~~~~~l~gh~~~vi~~~~~s~~~~~~~~~la~~~~~~~~~~~~~~~~~iwd~~~~~~~~~l~~h~~~vi~~~~~s--~~~   93 (635)
                      +++..|+||.+.| +||+||    |||++||+++.+        ..+.||| .+++++++|.+|.+.| ++++|+  +++
T Consensus         7 ~e~~~L~GH~~~V-~~~a~s----pdg~~las~~~d--------~~v~iWd-~~~~~~~~l~gh~~~V-~~l~fspdg~~   71 (577)
T 2ymu_A            7 KERNRLEAHSSSV-RGVAFS----PDGQTIASASDD--------KTVKLWN-RNGQLLQTLTGHSSSV-WGVAFSPDGQT   71 (577)
T ss_dssp             CEEEEECCCSSCE-EEEEEC----TTSSCEEEEETT--------SEEEEEC-TTSCEEEEEECCSSCE-EEEEECTTSSE
T ss_pred             EEeeEECCCCCcE-EEEEEC----CCCCEEEEEeCC--------CEEEEEE-CCCCEEEEEeCCCCCE-EEEEECCCCCE
Confidence            3446699999999 999999    999999999764        4455799 5788999999999998 999999  999


Q ss_pred             EEEeeCCCcEEEEECCCCcEE---------------------EEEeeCCCcEEEEeCCCCeEEEEeeCCCcceEEEEe--
Q psy18018         94 IVSGSDDNTLKVWSATTGKCL---------------------LVSGSRDATLRVWHIESGECLHVLVGHLAAVRCVQY--  150 (635)
Q Consensus        94 l~s~~~d~~v~vWd~~~~~~l---------------------l~~~~~dg~i~vwd~~~~~~~~~l~~h~~~v~~l~~--  150 (635)
                      ||+++.|++|+|||.. ++.+                     +++++.|+.+++|+... .....+.+|...|.++.+  
T Consensus        72 las~~~d~~i~vWd~~-~~~~~~~~~~~~~v~~~~~s~d~~~l~~~~~d~~~~~~~~~~-~~~~~~~~~~~~v~~~~~~~  149 (577)
T 2ymu_A           72 IASASDDKTVKLWNRN-GQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNG-QLLQTLTGHSSSVWGVAFSP  149 (577)
T ss_dssp             EEEEETTSCEEEEETT-SCEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTC-CEEEEECCCSSCEEEEEECT
T ss_pred             EEEEeCCCEEEEEECC-CCEEEEEECCCCCEEEEEECCCCCEEEEEcCCCceeeccccc-ceeeeccCCCCceeeeeeec
Confidence            9999999999999964 4433                     88999999999999754 456677789999999999  


Q ss_pred             cCCEEEEEeCCCeEEEEeCCCccceeeccccceeEEeeeccCCCEEEEEeCCCcEEEEECCCCeEEEEEeCCCCCeEEEE
Q psy18018        151 DGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTGGVWSSQ  230 (635)
Q Consensus       151 ~~~~l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~dg~i~vwd~~~~~~~~~~~~h~~~v~~~~  230 (635)
                      ++..+++++.++.+++|+...............+......+++..+++++.|+.|++||. +++.+..+.+|...|.+++
T Consensus       150 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~v~~w~~-~~~~~~~~~~~~~~v~~~~  228 (577)
T 2ymu_A          150 DGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNR-NGQLLQTLTGHSSSVRGVA  228 (577)
T ss_dssp             TSSCEEEEETTSEEEEECTTSCEEEEEECCSSCEEEEEECTTSSCEEEEETTSEEEEECT-TSCEEEEEECCSSCEEEEE
T ss_pred             CCccceecccccceeccccceeeeeeccCCCcceeeeeecCCCCEEEEEcCCCEEEEEeC-CCcEEEEEecCCCCEEEEE
Confidence            888999999999999999766554444444455566666677889999999999999995 6788899999999999999


Q ss_pred             ee--CCEEEEeeCceeEEEecccceeeeccccccccCccceeeeeeeeccccccceeeccccceeeEEEeecCchhhHhh
Q psy18018        231 MA--GNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPEDLLRA  308 (635)
Q Consensus       231 ~~--~~~l~s~~~dg~i~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (635)
                      |+  +..|++++.|+.|++|+.......                             ........+..+.|.|++..+..
T Consensus       229 ~s~dg~~l~~~~~d~~i~~w~~~~~~~~-----------------------------~~~~~~~~v~~v~~~~d~~~l~~  279 (577)
T 2ymu_A          229 FSPDGQTIASASDDKTVKLWNRNGQLLQ-----------------------------TLTGHSSSVNGVAFRPDGQTIAS  279 (577)
T ss_dssp             ECTTSSCEEEEETTSCEEEECTTSCEEE-----------------------------EECCCSSCEEEEEECTTSSEEEE
T ss_pred             ECCCCCEEEEEeCCCEEEEEeCCCCEEE-----------------------------EEecCCCCEEEEEEcCCCCEEEE
Confidence            95  789999999999999996543211                             01112334555667777666555


Q ss_pred             cccccceeEeecCCcchhhhhhhhhhhccccccCCCceEEEEecCcEEEEecCCCeEEEEEccCCceEEeeeCCCcceeE
Q psy18018        309 AQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSG  388 (635)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~l~~~~~dg~i~v~~~~~~~~~~~~~~~~~~v~~  388 (635)
                      +.......+........       .  ....+......++++|++.++++++.|+.|++|+.. +..+..+.+|...+.+
T Consensus       280 ~~~d~~i~~w~~~~~~~-------~--~~~~h~~~v~~~~~~~~~~~l~t~~~d~~i~~w~~~-~~~~~~~~~~~~~v~~  349 (577)
T 2ymu_A          280 ASDDKTVKLWNRNGQLL-------Q--TLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRN-GQHLQTLTGHSSSVWG  349 (577)
T ss_dssp             EETTSCEEEEETTSCEE-------E--EECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETT-SCEEEEECCCSSCEEE
T ss_pred             EeCCCEEEEEeCCCcEE-------E--EEecCCCCeEEEEECCCCCEEEEEeCCCeEEEEeCC-CCeeEEEeCCCCCEEE
Confidence            44333333322211110       0  011223345567899999999999999999999976 5566788899999999


Q ss_pred             EEEe--CCEEEEEeCCCcEEEEEccCCc--------ceeEEEEEeeCCcEEEEEeCCCcEEEEeCCCCceeeeeccCCcc
Q psy18018        389 MELR--NNILVSGNADSTVKVWDIVSGT--------KKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSL  458 (635)
Q Consensus       389 l~~~--~~~l~s~~~dg~i~iwd~~~~~--------~~~~~~~~~~~~~~l~~~~~d~~i~~~d~~~~~~~~~~~~~~~~  458 (635)
                      ++++  +..+++++.|+.+++|+.....        .......++|++++|++++.|+.|++||. +++.+..+.+|...
T Consensus       350 ~~~s~~g~~l~~~~~dg~v~~~~~~~~~~~~~~~~~~~v~~~~~s~dg~~l~~~~~d~~v~~~~~-~~~~~~~~~~~~~~  428 (577)
T 2ymu_A          350 VAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNR-NGQLLQTLTGHSSS  428 (577)
T ss_dssp             EEECTTSSEEEEEETTSEEEEEETTCCEEEEEECCSSCEEEEEECTTSSCEEEEETTSEEEEECT-TCCEEEEEECCSSC
T ss_pred             EEECCCCCEEEEEeCCCEEEEEcCCCCEEEEecCCCCCeEEEEECCCCCEEEEEeCCCEEEEEeC-CCCEEEEecCCCCC
Confidence            9997  6799999999999999965321        11222347899999999999999999995 57888899999999


Q ss_pred             EEEEEec--CCEEEEEeCCCcEEEEECCCCceeEEecCCCcccccEEEEEe--cCCEEEEEeCCCcEEEEECCCCceeee
Q psy18018        459 TSGMELR--NNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQF--NSRFVITSSDDGTVKLWDVKTGEFSTP  534 (635)
Q Consensus       459 v~~~~~~--~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~v~~~~~--~~~~l~~~~~d~~i~vwd~~~~~~~~~  534 (635)
                      |.+++++  +++|++++.|+.|++||. +++.+..+..   |...|.+++|  ++++|++++.|+.|++||. +++.+..
T Consensus       429 v~~~~~s~d~~~l~~~~~d~~v~~w~~-~~~~~~~~~~---~~~~v~~~~~spd~~~las~~~d~~i~iw~~-~~~~~~~  503 (577)
T 2ymu_A          429 VWGVAFSPDDQTIASASDDKTVKLWNR-NGQLLQTLTG---HSSSVRGVAFSPDGQTIASASDDKTVKLWNR-NGQLLQT  503 (577)
T ss_dssp             EEEEEECTTSSEEEEEETTSEEEEEET-TSCEEEEEEC---CSSCEEEEEECTTSCEEEEEETTSEEEEEET-TSCEEEE
T ss_pred             eEEEEECCCCCEEEEEcCCCEEEEEEC-CCCEEEEEcC---CCCCEEEEEEcCCCCEEEEEeCCCEEEEEcC-CCCEEEE
Confidence            9999884  669999999999999996 4677778877   8899999999  6899999999999999995 5666555


Q ss_pred             eccceecCceeEEeccCceecccccCCCeEEEEecCCCeEEEEeCCCCceEEeeeeccCCCCCceEEEEEeCCCCeEEEE
Q psy18018        535 LMSSFILNPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAV  614 (635)
Q Consensus       535 ~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~d~~v~iwd~~~~~~~~~~~~~~~~~~~~~i~~l~~s~d~~~l~~  614 (635)
                      +..           |...|++++|+||+++||+++.|+.|++||. +++++..+     .+|.++|++++|+|||++|++
T Consensus       504 ~~~-----------h~~~v~~l~~s~dg~~l~s~~~dg~v~lwd~-~~~~~~~~-----~~h~~~v~~~~fs~dg~~l~s  566 (577)
T 2ymu_A          504 LTG-----------HSSSVRGVAFSPDGQTIASASDDKTVKLWNR-NGQLLQTL-----TGHSSSVWGVAFSPDGQTIAS  566 (577)
T ss_dssp             EEC-----------CSSCEEEEEECTTSSCEEEEETTSEEEEECT-TSCEEEEE-----ECCSSCEEEEEECTTSSCEEE
T ss_pred             EeC-----------CCCCEEEEEEcCCCCEEEEEECcCEEEEEeC-CCCEEEEE-----cCCCCCEEEEEEcCCCCEEEE
Confidence            543           7889999999999999999999999999996 68888888     579999999999999999999


Q ss_pred             ccCCCeeEeEEE
Q psy18018        615 GSRNGTEETKLL  626 (635)
Q Consensus       615 ~~~dg~~~~~l~  626 (635)
                      ++.|++  +++|
T Consensus       567 ~~~D~~--i~~W  576 (577)
T 2ymu_A          567 ASSDKT--VKLW  576 (577)
T ss_dssp             EETTSC--EEEE
T ss_pred             EeCCCE--EEEe
Confidence            999998  4554



>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 635
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-40
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-34
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-29
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-20
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-17
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-30
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-24
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-22
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-22
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-22
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-16
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-25
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-23
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-20
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-19
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-12
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 9e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-24
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-16
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-16
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-22
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-22
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-13
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-12
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 2e-22
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-22
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-14
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-12
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-21
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-15
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-15
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-13
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 9e-08
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-14
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-06
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-05
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 3e-14
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-14
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 9e-13
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-08
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-05
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-14
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-12
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-14
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-12
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-08
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-13
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-11
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.001
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-13
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-10
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 6e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 8e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-13
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-13
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-12
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-09
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-09
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 9e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-13
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-11
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-08
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 9e-04
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 2e-12
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-10
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.001
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 3e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-09
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-09
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-07
d1mdah_ 368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-04
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 6e-08
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 5e-07
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-06
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-05
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 5e-04
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.002
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.003
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 7e-08
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-05
d1l0qa2 301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.004
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-07
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-07
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-06
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-05
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.002
d1qnia2 441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 7e-04
d1ri6a_ 333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 9e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.002
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  148 bits (372), Expect = 3e-40
 Identities = 138/332 (41%), Positives = 187/332 (56%), Gaps = 60/332 (18%)

Query: 349 FQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVS---------- 398
            QF G  +VSGS D +++VW A +G    TL+GH       ++R+NI++S          
Sbjct: 23  LQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVW 82

Query: 399 ------------------------------GNADSTVKVWDIVSGTKKLMF-------RI 421
                                         G+ D+T++VWDI +G    +        R 
Sbjct: 83  NAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRC 142

Query: 422 CLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMELRNNILVSGNADSTVKVW 481
             +DG  VVSG+ D  ++VW+ E+    HTL GH +    ++     +VSG+ D++++VW
Sbjct: 143 VQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVW 202

Query: 482 DIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFIL 541
           D+ +G C+ TL+G   HQS  + ++     +++ + D TVK+WD+KTG+           
Sbjct: 203 DVETGNCIHTLTG---HQSLTSGMELKDNILVSGNADSTVKIWDIKTGQC---------- 249

Query: 542 NPFYFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVW 601
                           LQFN  FVITSSDDGTVKLWD+KTGEFIRNLV+L+SGGSGGVVW
Sbjct: 250 LQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVW 309

Query: 602 RIRASETKLVCAVGSRNGTEETKLLVLDFDVD 633
           RIRAS TKLVCAVGSRNGTEETKLLVLDFDVD
Sbjct: 310 RIRASNTKLVCAVGSRNGTEETKLLVLDFDVD 341


>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query635
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.85
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.84
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.83
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.8
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.75
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.71
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.7
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.65
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.65
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.55
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.47
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.34
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.33
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.22
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.04
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.88
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.82
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.74
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.68
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.64
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.55
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.52
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.5
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.49
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.45
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.43
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.39
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.34
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.34
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.33
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 98.32
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.3
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 98.29
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.27
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.23
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 98.21
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.91
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.88
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.84
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.73
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.59
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.58
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.55
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.54
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.53
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.52
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.26
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.16
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.59
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.55
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 95.43
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 95.3
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 94.34
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 94.03
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.5
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.39
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.71
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 89.85
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 88.38
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 88.11
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 84.19
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 83.53
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 83.0
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.5e-41  Score=320.66  Aligned_cols=341  Identities=55%  Similarity=0.952  Sum_probs=264.4

Q ss_pred             eecCCCCCCceeeccCcceEEEEEEcCCEEEEeeCCCcEEEEECCCCcEEEEEeeCCCcEEEEeCCCCeEEEEeeCCCcc
Q psy18018         65 WRTRPIKDPKVLKGHDDHVITCLQFSGSRIVSGSDDNTLKVWSATTGKCLLVSGSRDATLRVWHIESGECLHVLVGHLAA  144 (635)
Q Consensus        65 wd~~~~~~~~~l~~h~~~vi~~~~~s~~~l~s~~~d~~v~vWd~~~~~~ll~~~~~dg~i~vwd~~~~~~~~~l~~h~~~  144 (635)
                      |+..+.++.+.|+||++.|+.|++|+|++||||+.||+|+|||+.+                     +++++++.+|.++
T Consensus         1 W~~~~~~~~~~l~GH~~~V~s~~~~~g~~l~sgs~Dg~i~vWd~~~---------------------~~~~~~~~~h~~~   59 (342)
T d2ovrb2           1 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVT---------------------GKCLRTLVGHTGG   59 (342)
T ss_dssp             HHHSCCCCCEEEECSTTSCEEEEEEETTEEEEEETTSCEEEEETTT---------------------CCEEEECCCCSSC
T ss_pred             CCCCCCCcCEEECCcCCceEEEEEECCCEEEEEeCCCeEEEEECCC---------------------CCEEEEEeCCCCC
Confidence            7778889999999999999888999999999999999999988764                     5667888999999


Q ss_pred             eEEEEecCCEEEEEeCCCeEEEEeCCCccceeeccccceeEEeeeccCCCEEEEEeCCCcEEEEECCCCeEEEEEeCCCC
Q psy18018        145 VRCVQYDGKLVVSGAYDYMVKIWNPDTEECLHAELQETEVELSHGYALRSRIVSGSDDNTLKVWSATTGKCLRTLIGHTG  224 (635)
Q Consensus       145 v~~l~~~~~~l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~dg~i~vwd~~~~~~~~~~~~h~~  224 (635)
                      |.+++|++.+|++++.|+++++|+.......                                         .....+..
T Consensus        60 V~~v~~~~~~l~s~s~D~~~~~~~~~~~~~~-----------------------------------------~~~~~~~~   98 (342)
T d2ovrb2          60 VWSSQMRDNIIISGSTDRTLKVWNAETGECI-----------------------------------------HTLYGHTS   98 (342)
T ss_dssp             EEEEEEETTEEEEEETTSCEEEEETTTTEEE-----------------------------------------EEECCCSS
T ss_pred             EEEEEeCCCccccceecccccccccccccce-----------------------------------------ecccccce
Confidence            9999997789999999998888886543321                                         11222222


Q ss_pred             CeEEEEeeCCEEEEeeCceeEEEecccceeeeccccccccCccceeeeeeeeccccccceeeccccceeeEEEeecCchh
Q psy18018        225 GVWSSQMAGNIIISGSTDRTLKGWSNAERILAIGQLIDSCEPTQIRHMMQLIEPQFQRDFISLLPRELALYVLTFLQPED  304 (635)
Q Consensus       225 ~v~~~~~~~~~l~s~~~dg~i~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  304 (635)
                      .+......+                                                                       
T Consensus        99 ~~~~~~~~~-----------------------------------------------------------------------  107 (342)
T d2ovrb2          99 TVRCMHLHE-----------------------------------------------------------------------  107 (342)
T ss_dssp             CEEEEEEET-----------------------------------------------------------------------
T ss_pred             eEeeeeccc-----------------------------------------------------------------------
Confidence            222222222                                                                       


Q ss_pred             hHhhcccccceeEeecCCcchhhhhhhhhhhccccccCCCceEEEEecCcEEEEecCCCeEEEEEccCCceEEeeeCCCc
Q psy18018        305 LLRAAQTCRSWRFLAEDNLLWREKCLEAATLHRNKKTHVPDLFGFQFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQS  384 (635)
Q Consensus       305 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~l~~~~~dg~i~v~~~~~~~~~~~~~~~~~  384 (635)
                                                                       ..+..+..++.+.+|+..+++....+..+..
T Consensus       108 -------------------------------------------------~~~~~~~~d~~i~~~~~~~~~~~~~~~~~~~  138 (342)
T d2ovrb2         108 -------------------------------------------------KRVVSGSRDATLRVWDIETGQCLHVLMGHVA  138 (342)
T ss_dssp             -------------------------------------------------TEEEEEETTSEEEEEESSSCCEEEEEECCSS
T ss_pred             -------------------------------------------------ccccccccceeEEEeecccccceeeeecccc
Confidence                                                             2344445555566666555554444433332


Q ss_pred             ceeEEEEeCCEEEEEeCCCcEEEEEccCCcceeEEEEEeeCCcEEEEEeCCCcEEEEeCCCCceeeeeccCCccEEEEEe
Q psy18018        385 LTSGMELRNNILVSGNADSTVKVWDIVSGTKKLMFRICLFDGVHVVSGSLDTSIRVWEAESGNLRHTLMGHQSLTSGMEL  464 (635)
Q Consensus       385 ~v~~l~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~l~~~~~d~~i~~~d~~~~~~~~~~~~~~~~v~~~~~  464 (635)
                      ......                                 +....++.++.|+.+++||....+.+..+.+|...+..+.+
T Consensus       139 ~~~~~~---------------------------------~~~~~~~~~~~d~~i~~~d~~~~~~~~~~~~~~~~~~~~~~  185 (342)
T d2ovrb2         139 AVRCVQ---------------------------------YDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQF  185 (342)
T ss_dssp             CEEEEE---------------------------------ECSSCEEEEETTSCEEEEEGGGTEEEEEECCCSSCEEEEEE
T ss_pred             cceeec---------------------------------cccceeeeecCCCeEEEeecccceeeEEEcCcccccccccC
Confidence            222222                                 23334566667777777777777888888899999999999


Q ss_pred             cCCEEEEEeCCCcEEEEECCCCceeEEecCCCcccccEEEEEecCCEEEEEeCCCcEEEEECCCCceeeeeccceecCce
Q psy18018        465 RNNILVSGNADSTVKVWDIVSGQCLQTLSGRNKHQSAVTCLQFNSRFVITSSDDGTVKLWDVKTGEFSTPLMSSFILNPF  544 (635)
Q Consensus       465 ~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~l~~~~~d~~i~vwd~~~~~~~~~~~~~~~~~~~  544 (635)
                      ++.++++++.||.|++||++.++++..+..   |...+.++++++++|++++.|+.|++||+...+....+....     
T Consensus       186 ~~~~l~s~~~dg~i~~~d~~~~~~~~~~~~---~~~~v~~~~~~~~~l~s~s~d~~i~iwd~~~~~~~~~~~~~~-----  257 (342)
T d2ovrb2         186 DGIHVVSGSLDTSIRVWDVETGNCIHTLTG---HQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPN-----  257 (342)
T ss_dssp             CSSEEEEEETTSCEEEEETTTCCEEEEECC---CCSCEEEEEEETTEEEEEETTSCEEEEETTTCCEEEEECSTT-----
T ss_pred             CCCEEEEEeCCCeEEEeecccceeeeEecc---cccceeEEecCCCEEEEEcCCCEEEEEecccccccccccccc-----
Confidence            999999999999999999999999988887   888999999999999999999999999999888766654421     


Q ss_pred             eEEeccCceecccccCCCeEEEEecCCCeEEEEeCCCCceEEeeeeccCCCCCceEEEEEeCCCCeEEEEccCCCeeEeE
Q psy18018        545 YFLIYSQPLLCPHLQFNSRFVITSSDDGTVKLWDVKTGEFIRNLVSLDSGGSGGVVWRIRASETKLVCAVGSRNGTEETK  624 (635)
Q Consensus       545 ~~~~~~~~v~~~~~s~~~~~l~~~~~d~~v~iwd~~~~~~~~~~~~~~~~~~~~~i~~l~~s~d~~~l~~~~~dg~~~~~  624 (635)
                         .|...+.++.+  +++++++|+.||+|++||+++++.++.+......+|.+.|++++|+|++.+||+|+.||+...+
T Consensus       258 ---~~~~~~~~~~~--~~~~~~s~s~Dg~i~iwd~~tg~~i~~~~~~~~~~~~~~v~~v~~s~~~~~la~g~~dGt~~~~  332 (342)
T d2ovrb2         258 ---KHQSAVTCLQF--NKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETK  332 (342)
T ss_dssp             ---SCSSCEEEEEE--CSSEEEEEETTSEEEEEETTTCCEEEEEEECTTGGGTCEEEEEEECSSEEEEEEECSSSSSCCE
T ss_pred             ---eeeeceeeccc--CCCeeEEEcCCCEEEEEECCCCCEEEEEecccCCCCCCCEEEEEECCCCCEEEEEeCCCCCeeE
Confidence               13444555444  6679999999999999999999999988766666788999999999999999999999988889


Q ss_pred             EEEEeeecC
Q psy18018        625 LLVLDFDVD  633 (635)
Q Consensus       625 l~~~d~~~~  633 (635)
                      |++|||+.+
T Consensus       333 l~~~Df~~~  341 (342)
T d2ovrb2         333 LLVLDFDVD  341 (342)
T ss_dssp             EEEEECCCC
T ss_pred             EEEEeCCCC
Confidence            999999875



>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure