Diaphorina citri psyllid: psy18020


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MTNLSGLVYHIPVCIWLMDTHPDHAPICYVRPTADMRINVSQNVDHTGKIYSPYLHTWTPQNSKLEGLIKTLASAFSALPPLYSSRTKQEPATNPTYNGNIRPTADMRINVSQNVDHTGKIYSPYLHTWTAQNSKLEGLIKTLASAFSALPPLYSSRTKQEPATNPTYNGNMASNAPYPTQSYMPMPGSNVNTPYPTYPPSAYPGYNPNAAAAPSGSIYPSYPTPGATPGAGGYSPYPLYPPGGSTPATPYPVPTPSPAPAVTSGGTITDEHIKMSLKSAVEDKIRRKMNEQKVQAQEEIEILKQTENELNQGKFKLARMFERIDKEKAELERSISFLKEKETELDEILAVLTEKTEVDVDEAVTTTAPIYKQILNTFTEEAATEDTIYYMGEALRRGVIDLEVYLKQVRSLSRKQFMFRALLFKCYKHISYAR
cCECccccccccEEEEEcccccccccEEEEEccccccccccccccccccEEcccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MTNLSGLVYHIPVCIWLMDTHPDHAPICYVRPTADMRINVSQNVDHTGKIYSPYLHTWTPQNSKLEGLIKTLASAFSALPPLYS**********************MRINVSQNVDHTGKIYSPYLHTWTAQNSKLEGLIKTLASAFSAL***********************************************************************************************************************************************************************************ELERSISFLKEKETELDEILAVLTEKTEVDVDEAVTTTAPIYKQILNTFTEEAATEDTIYYMGEALRRGVIDLEVYLKQVRSLSRKQFMFRALLFKCYKHIS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNLSGLVYHIPVCIWLMDTHPDHAPICYVRPTADMRINVSQNVDHTGKIYSPYLHTWTPQNSKLEGLIKTLASAFSALPPLYSSRTKQEPATNPTYNGNIRPTADMRINVSQNVDHTGKIYSPYLHTWTAQNSKLEGLIKTLASAFSALPPLYSSRTKQEPATNPTYNGNMASNAPYPTQSYMPMPGSNVNTPYPTYPPSAYPGYNPNAAAAPSGSIYPSYPTPGATPGAGGYSPYPLYPPGGSTPATPYPVPTPSPAPAVTSGGTITDEHIKMSLKSAVEDKIxxxxxxxxxxxxxxxxxxxxxxxxxxxxKFKLARMxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAVLTEKTEVDVDEAVTTTAPIYKQILNTFTEEAATEDTIYYMGEALRRGVIDLEVYLKQVRSLSRKQFMFRALLFKCYKHISYAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tumor susceptibility gene 101 protein Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses.confidentQ99816
Tumor susceptibility gene 101 protein Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator.confidentQ61187
Tumor susceptibility gene 101 protein Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator.confidentQ6IRE4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OBQ, chain A
Confidence level:very confident
Coverage over the Query: 2-86
View the alignment between query and template
View the model in PyMOL
Template: 3OBQ, chain A
Confidence level:very confident
Coverage over the Query: 99-156
View the alignment between query and template
View the model in PyMOL
Template: 2P22, chain A
Confidence level:very confident
Coverage over the Query: 276-430
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 197-209
View the alignment between query and template
View the model in PyMOL