Diaphorina citri psyllid: psy18031


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MRLLNKRLVRTYEVLTHTSADVHDFESSKTHLIFVYISGALQKWAWEYSGFRKYGLYYDDLANETPVVEEALRRLPEKLKNERHFRQLRAVQLNIQKSILPKDQWTKYEDETRYLKPYIEQVEKEFKEKEEWGKLY
cccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcc
****NKRLVRTYEVLTHTSADVHDFESSKTHLIFVYISGALQKWAWEYSGFRKYGLYYDDLANETPVVEEALRRLPEKLKNERHFRQLRAVQLNIQKSILPKDQWTKYEDETRYLKPYIEQVEKEFKEKEE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLNKRLVRTYEVLTHTSADVHDFESSKTHLIFVYISGALQKWAWEYSGFRKYGLYYDDLANETPVVEEALRRLPEKLKNERHFRQLRAVQLNIQKSILPKDQWTKYEDETRYLKPYIEQVEKEFKEKEEWGKLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b-c1 complex subunit 7 This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.confidentQ5RC24
Cytochrome b-c1 complex subunit 7 This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.confidentP00129
Cytochrome b-c1 complex subunit 7 This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.confidentQ9D855

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005750 [CC]mitochondrial respiratory chain complex IIIprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0045275, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PP9, chain F
Confidence level:very confident
Coverage over the Query: 37-123
View the alignment between query and template
View the model in PyMOL