Diaphorina citri psyllid: psy18034


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MTVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAARGIDIPSLDAVINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSSDELCYYLDLLLFLGRKPVLADDSMKGKIRHQDGMFGKIPQGLMEDQISEIMNWVELDADMEGIQKTCNNAYKKYVKSRPGASVESVKKVKELELATMQVHPLFRNIGSAEQEKFNLLTKMSEYRPPSTVLEFGKARFIIINIYYVY
cEEEEEcccccHHHHHHHHHHcccCEEEEcccccHHHHHHHHHHcccccccEEEEEccccccccccccccEEEccccccccccEEccccccccccccEEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccEEEEccccccEEEEEEEc
MTVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAARGIDIPSLDAVINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSSDELCYYLDLLLFLGRKPVLADDSMKGKIRHQDGMFGKIPQGLMEDQISEIMNWVELDADMEGIQKTCNNAYKKY***********VKKVKELELATMQVHPLFRNIGSAEQEKFNLLTKMSEYRPPSTVLEFGKARFIIINIYYVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAARGIDIPSLDAVINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSSDELCYYLDLLLFLGRKPVLADDSMKGKIRHQDGMFGKIPQGLMEDQISEIMNWVELDADMEGIQKTCNNAYKKYVKSRPGASVESVKKVKELELATMQVHPLFRNIGSAEQEKFNLLTKMSEYRPPSTVLEFGKARFIIINIYYVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006139 [BP]nucleobase-containing compound metabolic processprobableGO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0030687 [CC]preribosome, large subunit precursorprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0032550 [MF]purine ribonucleoside bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:0032549, GO:1901363, GO:0001883, GO:0001882
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004004 [MF]ATP-dependent RNA helicase activityprobableGO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0045495 [CC]pole plasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0032559 [MF]adenyl ribonucleotide bindingprobableGO:0030554, GO:0097159, GO:0000166, GO:0036094, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:1901363, GO:1901265, GO:0005488
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003727 [MF]single-stranded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I32, chain A
Confidence level:very confident
Coverage over the Query: 1-131
View the alignment between query and template
View the model in PyMOL