Psyllid ID: psy18034
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 251 | ||||||
| 328781928 | 772 | PREDICTED: ATP-dependent RNA helicase DD | 0.928 | 0.301 | 0.563 | 1e-75 | |
| 380029382 | 772 | PREDICTED: ATP-dependent RNA helicase DD | 0.924 | 0.300 | 0.561 | 2e-75 | |
| 350423736 | 772 | PREDICTED: ATP-dependent RNA helicase DD | 0.924 | 0.300 | 0.561 | 3e-75 | |
| 340723049 | 772 | PREDICTED: LOW QUALITY PROTEIN: ATP-depe | 0.924 | 0.300 | 0.556 | 2e-74 | |
| 242015175 | 723 | ATP-dependent RNA helicase DDX54, putati | 0.944 | 0.327 | 0.567 | 8e-74 | |
| 322787030 | 775 | hypothetical protein SINV_10425 [Solenop | 0.924 | 0.299 | 0.552 | 1e-73 | |
| 270000966 | 761 | hypothetical protein TcasGA2_TC011242 [T | 0.920 | 0.303 | 0.588 | 1e-72 | |
| 156552297 | 782 | PREDICTED: ATP-dependent RNA helicase DD | 0.920 | 0.295 | 0.567 | 2e-72 | |
| 307175593 | 751 | ATP-dependent RNA helicase DDX54 [Campon | 0.924 | 0.308 | 0.544 | 2e-72 | |
| 383849107 | 770 | PREDICTED: ATP-dependent RNA helicase DD | 0.924 | 0.301 | 0.544 | 6e-72 |
| >gi|328781928|ref|XP_397101.4| PREDICTED: ATP-dependent RNA helicase DDX54-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Score = 288 bits (738), Expect = 1e-75, Method: Compositional matrix adjust.
Identities = 134/238 (56%), Positives = 179/238 (75%), Gaps = 5/238 (2%)
Query: 1 MTVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAA 60
TV+F AT +HVEY+H+IL AGIS+TYIYS+LD +ARKINAAKFQT K+ VL+VTDVAA
Sbjct: 280 QTVIFAATMHHVEYIHQILEKAGISNTYIYSNLDASARKINAAKFQTNKVHVLIVTDVAA 339
Query: 61 RGIDIPSLDAVINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSSDELCYYLDLLLFLGR 120
RG+DIP LD VIN+NFP K+KLFVHRVGRCARAGR+G AY++VS DE Y LDL LFLGR
Sbjct: 340 RGLDIPHLDNVINFNFPAKSKLFVHRVGRCARAGRTGTAYNIVSPDEYAYLLDLHLFLGR 399
Query: 121 KPVLADDSMKGKIRHQDGMFGKIPQGLMEDQISEIMNWVELDADMEGIQKTCNNAYKKYV 180
+ S G I++ DG+ GK+PQ ++E+++ E++NW D++ ++K CNNAYK+Y+
Sbjct: 400 SLHIVPPS--GSIQNTDGIIGKLPQAMIEEELVELINWHNCSTDLKNMEKVCNNAYKQYI 457
Query: 181 KSRPGASVESVKKVKELELATMQVHPLFRNIGSAEQEKFNLLTKMSEYRPPSTVLEFG 238
+SRP AS ES+K+VK+L ++ V P + ++ S NLL+K+ YRP T+ E G
Sbjct: 458 RSRPAASSESIKRVKDLHISEAGVIPEYSDVSS---NTMNLLSKIVNYRPQGTIFEIG 512
|
Source: Apis mellifera Species: Apis mellifera Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380029382|ref|XP_003698353.1| PREDICTED: ATP-dependent RNA helicase DDX54-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350423736|ref|XP_003493575.1| PREDICTED: ATP-dependent RNA helicase DDX54-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340723049|ref|XP_003399911.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX54-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|242015175|ref|XP_002428249.1| ATP-dependent RNA helicase DDX54, putative [Pediculus humanus corporis] gi|212512810|gb|EEB15511.1| ATP-dependent RNA helicase DDX54, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|322787030|gb|EFZ13254.1| hypothetical protein SINV_10425 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|270000966|gb|EEZ97413.1| hypothetical protein TcasGA2_TC011242 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|156552297|ref|XP_001600622.1| PREDICTED: ATP-dependent RNA helicase DDX54-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307175593|gb|EFN65503.1| ATP-dependent RNA helicase DDX54 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383849107|ref|XP_003700188.1| PREDICTED: ATP-dependent RNA helicase DDX54-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 251 | ||||||
| UNIPROTKB|F1NTK9 | 822 | DDX54 "Uncharacterized protein | 0.980 | 0.299 | 0.465 | 3.7e-54 | |
| UNIPROTKB|E1BGI6 | 877 | DDX54 "Uncharacterized protein | 0.932 | 0.266 | 0.466 | 8.9e-52 | |
| RGD|1562539 | 906 | Ddx54 "DEAD (Asp-Glu-Ala-Asp) | 0.928 | 0.257 | 0.460 | 1.1e-51 | |
| MGI|MGI:1919240 | 874 | Ddx54 "DEAD (Asp-Glu-Ala-Asp) | 0.936 | 0.268 | 0.460 | 1.5e-51 | |
| UNIPROTKB|Q8TDD1 | 881 | DDX54 "ATP-dependent RNA helic | 0.936 | 0.266 | 0.455 | 3.3e-51 | |
| UNIPROTKB|F6UKZ0 | 569 | DDX54 "Uncharacterized protein | 0.928 | 0.409 | 0.457 | 2.8e-50 | |
| UNIPROTKB|E2QSR5 | 912 | DDX54 "Uncharacterized protein | 0.928 | 0.255 | 0.457 | 1.7e-49 | |
| ZFIN|ZDB-GENE-021220-2 | 862 | ddx54 "DEAD (Asp-Glu-Ala-Asp) | 0.940 | 0.273 | 0.441 | 2.7e-49 | |
| DICTYBASE|DDB_G0292992 | 1091 | helA "putative RNA helicase" [ | 0.920 | 0.211 | 0.456 | 1e-47 | |
| ZFIN|ZDB-GENE-050706-47 | 511 | zgc:111908 "zgc:111908" [Danio | 0.908 | 0.446 | 0.420 | 7.1e-45 |
| UNIPROTKB|F1NTK9 DDX54 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 562 (202.9 bits), Expect = 3.7e-54, P = 3.7e-54
Identities = 116/249 (46%), Positives = 163/249 (65%)
Query: 2 TVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAAR 61
TVVF ATK+H EY+ ++L GI T+IYS LD TARKIN AKF GK +VL+VTDVAAR
Sbjct: 280 TVVFVATKHHTEYLKELLTSQGICCTHIYSSLDQTARKINIAKFAHGKCQVLLVTDVAAR 339
Query: 62 GIDIPSLDAVINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSSDEXXXXXXXXXXXGRK 121
G+DIP LD VINY+FP K+KLF+HRVGR ARAGRSG AYSLV+ DE GR
Sbjct: 340 GLDIPMLDNVINYSFPAKSKLFLHRVGRVARAGRSGTAYSLVAPDEMPYIFDLHLFLGRP 399
Query: 122 PVLAD-DSMKGKIRHQDGMFGKIPQGLMEDQISEIMNWVELDADMEGIQKTCNNAYKKYV 180
+LA M DG+ G++PQ L++D+ ++ E +++ +++ +NA K+Y+
Sbjct: 400 LILAGAQEMPAGAADADGVLGRVPQSLVDDEECLLLTDHEGSLELQSLRRVADNAQKQYL 459
Query: 181 KSRPGASVESVKKVKELELATMQVHPLFR-NIGSAEQEKFNLLTKMSEYRPPSTVLEFGK 239
+SRPG S ES+K+VKE++L+ + +HPLF + E E+ L+ + Y+ +T+ E
Sbjct: 460 RSRPGPSPESIKRVKEMDLSQLGIHPLFSAHFEDTELERLKLVDSIKAYKSKATIFEINS 519
Query: 240 -ARFIIINI 247
AR + +I
Sbjct: 520 TARTLASSI 528
|
|
| UNIPROTKB|E1BGI6 DDX54 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1562539 Ddx54 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 54" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919240 Ddx54 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 54" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TDD1 DDX54 "ATP-dependent RNA helicase DDX54" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6UKZ0 DDX54 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QSR5 DDX54 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-021220-2 ddx54 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 54" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0292992 helA "putative RNA helicase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050706-47 zgc:111908 "zgc:111908" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 251 | |||
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 7e-34 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 5e-28 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 7e-27 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-25 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 3e-23 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 4e-23 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 5e-22 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 5e-18 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 4e-17 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 5e-17 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 5e-17 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 2e-16 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 2e-15 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 8e-10 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 3e-08 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 4e-07 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 4e-07 | |
| COG1111 | 542 | COG1111, MPH1, ERCC4-like helicases [DNA replicati | 7e-07 | |
| PRK13766 | 773 | PRK13766, PRK13766, Hef nuclease; Provisional | 8e-06 | |
| TIGR03817 | 742 | TIGR03817, DECH_helic, helicase/secretion neighbor | 2e-04 | |
| TIGR01389 | 591 | TIGR01389, recQ, ATP-dependent DNA helicase RecQ | 0.002 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 127 bits (320), Expect = 7e-34
Identities = 48/106 (45%), Positives = 64/106 (60%)
Query: 2 TVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAAR 61
+VF TK VE + + L G ++ DL R KF+ G++RVLV TDVAAR
Sbjct: 276 VIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVAAR 335
Query: 62 GIDIPSLDAVINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSSDE 107
G+DIP + VINY+ P + +VHR+GR RAGR GVA S V+ +E
Sbjct: 336 GLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEE 381
|
Length = 513 |
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 251 | |||
| KOG0337|consensus | 529 | 100.0 | ||
| KOG0345|consensus | 567 | 100.0 | ||
| KOG0328|consensus | 400 | 100.0 | ||
| KOG0342|consensus | 543 | 100.0 | ||
| KOG0330|consensus | 476 | 99.97 | ||
| KOG0331|consensus | 519 | 99.97 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.97 | |
| KOG0340|consensus | 442 | 99.97 | ||
| KOG0333|consensus | 673 | 99.96 | ||
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.96 | |
| KOG0326|consensus | 459 | 99.96 | ||
| KOG0348|consensus | 708 | 99.95 | ||
| KOG0332|consensus | 477 | 99.95 | ||
| KOG0343|consensus | 758 | 99.95 | ||
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.95 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.95 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.95 | |
| PTZ00110 | 545 | helicase; Provisional | 99.95 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.95 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.95 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.94 | |
| KOG0338|consensus | 691 | 99.94 | ||
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.94 | |
| KOG0336|consensus | 629 | 99.94 | ||
| PTZ00424 | 401 | helicase 45; Provisional | 99.94 | |
| KOG0347|consensus | 731 | 99.93 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.93 | |
| KOG0335|consensus | 482 | 99.93 | ||
| KOG0327|consensus | 397 | 99.93 | ||
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.92 | |
| KOG0341|consensus | 610 | 99.92 | ||
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.92 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.92 | |
| KOG0344|consensus | 593 | 99.91 | ||
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.91 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.9 | |
| KOG0350|consensus | 620 | 99.9 | ||
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.88 | |
| KOG0346|consensus | 569 | 99.88 | ||
| KOG0349|consensus | 725 | 99.88 | ||
| KOG0339|consensus | 731 | 99.86 | ||
| KOG4284|consensus | 980 | 99.86 | ||
| KOG0334|consensus | 997 | 99.86 | ||
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.85 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.85 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.84 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.84 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.84 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.84 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.83 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.83 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.83 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.82 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.81 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.81 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.8 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.8 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.8 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.8 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.8 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.8 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.78 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.78 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.77 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.76 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.75 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.75 | |
| KOG0354|consensus | 746 | 99.74 | ||
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.74 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.73 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.73 | |
| KOG0351|consensus | 941 | 99.72 | ||
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.7 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.7 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.7 | |
| KOG0352|consensus | 641 | 99.67 | ||
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.65 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.65 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.63 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.55 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.54 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.53 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.52 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.5 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.47 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.46 | |
| KOG0353|consensus | 695 | 99.43 | ||
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.41 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.38 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.37 | |
| KOG0329|consensus | 387 | 99.36 | ||
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.36 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.35 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.33 | |
| KOG0953|consensus | 700 | 99.32 | ||
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.31 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.31 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.22 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.18 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.17 | |
| KOG4150|consensus | 1034 | 99.17 | ||
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.13 | |
| KOG0950|consensus | 1008 | 99.08 | ||
| KOG0390|consensus | 776 | 98.95 | ||
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.95 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 98.94 | |
| KOG0384|consensus | 1373 | 98.9 | ||
| KOG0922|consensus | 674 | 98.84 | ||
| KOG0947|consensus | 1248 | 98.83 | ||
| KOG0385|consensus | 971 | 98.83 | ||
| KOG0387|consensus | 923 | 98.79 | ||
| KOG0951|consensus | 1674 | 98.78 | ||
| KOG0392|consensus | 1549 | 98.74 | ||
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 98.7 | |
| KOG0923|consensus | 902 | 98.68 | ||
| KOG0952|consensus | 1230 | 98.66 | ||
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 98.62 | |
| KOG0924|consensus | 1042 | 98.56 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.52 | |
| KOG0920|consensus | 924 | 98.51 | ||
| KOG0948|consensus | 1041 | 98.51 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.5 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 98.39 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 98.37 | |
| KOG1002|consensus | 791 | 98.35 | ||
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.34 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 98.31 | |
| KOG1000|consensus | 689 | 98.3 | ||
| KOG0388|consensus | 1185 | 98.27 | ||
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 98.26 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.21 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 98.21 | |
| KOG0389|consensus | 941 | 98.19 | ||
| KOG0391|consensus | 1958 | 98.17 | ||
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 98.14 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.13 | |
| KOG1123|consensus | 776 | 98.08 | ||
| KOG0949|consensus | 1330 | 98.07 | ||
| KOG0926|consensus | 1172 | 98.02 | ||
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 97.89 | |
| KOG0386|consensus | 1157 | 97.88 | ||
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 97.84 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 97.79 | |
| KOG1015|consensus | 1567 | 97.72 | ||
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.7 | |
| KOG4439|consensus | 901 | 97.59 | ||
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.58 | |
| PF13871 | 278 | Helicase_C_4: Helicase_C-like | 97.53 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.51 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 97.44 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 97.38 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 97.22 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 97.15 | |
| KOG0925|consensus | 699 | 97.15 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 96.97 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 96.95 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 96.62 | |
| KOG1016|consensus | 1387 | 96.53 | ||
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 96.52 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 96.49 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 96.22 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 96.16 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 96.15 | |
| PF13959 | 65 | DUF4217: Domain of unknown function (DUF4217) | 96.01 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 95.93 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 95.83 | |
| KOG1001|consensus | 674 | 95.81 | ||
| KOG0701|consensus | 1606 | 95.71 | ||
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 95.32 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 95.24 | |
| KOG1513|consensus | 1300 | 95.0 | ||
| KOG0339|consensus | 731 | 94.99 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 94.82 | |
| KOG2340|consensus | 698 | 94.71 | ||
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 94.57 | |
| KOG0331|consensus | 519 | 94.55 | ||
| PRK14701 | 1638 | reverse gyrase; Provisional | 94.37 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 94.25 | |
| PF10593 | 239 | Z1: Z1 domain; InterPro: IPR018310 This entry repr | 94.09 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 93.74 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 93.72 | |
| KOG0951|consensus | 1674 | 93.59 | ||
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 93.39 | |
| KOG0347|consensus | 731 | 93.39 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 92.93 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 92.66 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 92.6 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 92.4 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 91.94 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 91.72 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 91.57 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 91.53 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 91.28 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 90.14 | |
| PTZ00110 | 545 | helicase; Provisional | 89.92 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 89.17 | |
| KOG0921|consensus | 1282 | 88.51 | ||
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 88.49 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 88.05 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 87.45 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 87.13 | |
| KOG0334|consensus | 997 | 84.94 | ||
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 83.87 | |
| KOG0335|consensus | 482 | 83.41 | ||
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 83.41 | |
| KOG0298|consensus | 1394 | 83.19 | ||
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 82.83 | |
| KOG0330|consensus | 476 | 80.98 |
| >KOG0337|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-41 Score=299.37 Aligned_cols=239 Identities=45% Similarity=0.689 Sum_probs=220.2
Q ss_pred CEEEEcCcHHHHHHHHHHHHhCCCcEEEEcCCCCHHHHHHHHHHHhcCCceEEEeccccccccccccccEEEEecCCCCh
Q psy18034 1 MTVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAARGIDIPSLDAVINYNFPCKA 80 (251)
Q Consensus 1 k~iIF~~t~~~~~~l~~~L~~~~~~~~~i~g~~~~~~r~~~~~~F~~g~~~iLv~Td~~~~Gldi~~v~~VI~~d~P~~~ 80 (251)
+++|||+|+++|+++...|+..|+.+..++|.|+++.|...+.+|+.++..+||.||+++||+|+|..+.|||||+|.++
T Consensus 263 ~t~vf~~tk~hve~~~~ll~~~g~~~s~iysslD~~aRk~~~~~F~~~k~~~lvvTdvaaRG~diplldnvinyd~p~~~ 342 (529)
T KOG0337|consen 263 QTIVFVATKHHVEYVRGLLRDFGGEGSDIYSSLDQEARKINGRDFRGRKTSILVVTDVAARGLDIPLLDNVINYDFPPDD 342 (529)
T ss_pred ceeEEecccchHHHHHHHHHhcCCCccccccccChHhhhhccccccCCccceEEEehhhhccCCCccccccccccCCCCC
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHhhhcccCCCCceEEEEecCccHHHHHHHHHHhCCCCeeccCCccccccccccccccCCCcchhhHHHHHHHHHH
Q psy18034 81 KLFVHRVGRCARAGRSGVAYSLVSSDELCYYLDLLLFLGRKPVLADDSMKGKIRHQDGMFGKIPQGLMEDQISEIMNWVE 160 (251)
Q Consensus 81 ~~y~qr~GR~gR~g~~g~~i~l~~~~e~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (251)
..|+||+||++|+|+.|++|+++.+.+.+++.++..++|+++.....+..-.. ....+++..|+...+...+...++++
T Consensus 343 klFvhRVgr~aragrtg~aYs~V~~~~~~yl~DL~lflgr~~~~~~~~~e~d~-~~t~vigr~P~~~v~~~~~~~q~~~~ 421 (529)
T KOG0337|consen 343 KLFVHRVGRVARAGRTGRAYSLVASTDDPYLLDLQLFLGRPLIFAISHFEYDC-DDTTVIGRSPQSLVSLESEGHQSILE 421 (529)
T ss_pred ceEEEEecchhhccccceEEEEEecccchhhhhhhhhcCCceeeccchhhhcc-ccceeeccCcHHHHHHHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999987765433222 22247899999999999999999999
Q ss_pred hhHhhHHHHHHhHHHHHHHHhcCCCCchhhhhhhhccccccccccccccccCc-cHHHHHHHHHHhcCCCCCCceeeeec
Q psy18034 161 LDADMEGIQKTCNNAYKKYVKSRPGASVESVKKVKELELATMQVHPLFRNIGS-AEQEKFNLLTKMSEYRPPSTVLEFGK 239 (251)
Q Consensus 161 ~~~~~~~~~~~~~~~~~~y~~~r~~~~~~~i~r~k~l~~~~~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~tv~e~~~ 239 (251)
.+.+++.+.+.+.++.+.|.+++|+++++|++|+|+++..+ +.|+.+..-.+ +|.++.+++.++++||+.+||||+++
T Consensus 422 ~~~el~~l~~~a~ka~~~y~rtr~~~s~es~kR~ke~~~~~-g~~~~~~~~~e~~e~e~~~~~~kik~~r~~~tiFe~~~ 500 (529)
T KOG0337|consen 422 SNRELQVLARTADKAEMLYTRTRPSPSPESLKRAKEMISSK-GLHPRFKSFGENEEKEKLDILYKIKNYRSRETIFEINK 500 (529)
T ss_pred hhHHHHHHHHHHHHHHHHhhccCCCCCHHHHHHHHhhhccc-CCCcccccccchhhHHhhHHHHHHhhcccchhhhhhhh
Confidence 99999999999999999999999999999999999997776 77888876443 57888999999999999999999997
Q ss_pred cc
Q psy18034 240 AR 241 (251)
Q Consensus 240 ~~ 241 (251)
+.
T Consensus 501 ~~ 502 (529)
T KOG0337|consen 501 SD 502 (529)
T ss_pred hH
Confidence 64
|
|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13871 Helicase_C_4: Helicase_C-like | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG1016|consensus | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13959 DUF4217: Domain of unknown function (DUF4217) | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG0701|consensus | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1513|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2340|consensus | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 251 | ||||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 1e-17 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 2e-17 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 2e-17 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 2e-17 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 2e-17 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 2e-17 | ||
| 2yjt_D | 170 | Crystal Structure Of E. Coli Dead-Box Protein Srmb | 7e-17 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 4e-15 | ||
| 2p6n_A | 191 | Human Dead-box Rna Helicase Ddx41, Helicase Domain | 5e-15 | ||
| 2wax_A | 193 | Structure Of The Human Ddx6 C-Terminal Domain In Co | 1e-14 | ||
| 2hjv_A | 163 | Structure Of The Second Domain (Residues 207-368) O | 2e-14 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 3e-14 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 3e-14 | ||
| 2kbf_A | 187 | Solution Structure Of Carboxyl-Terminal Domain Of D | 5e-14 | ||
| 3gfp_A | 189 | Structure Of The C-Terminal Domain Of The Dead-Box | 5e-14 | ||
| 3peu_A | 188 | S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To | 6e-14 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 6e-14 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 6e-14 | ||
| 2jgn_A | 185 | Ddx3 Helicase Domain Length = 185 | 6e-14 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 9e-14 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 1e-12 | ||
| 3eaq_A | 212 | Novel Dimerization Motif In The Dead Box Rna Helica | 1e-12 | ||
| 3i32_A | 300 | Dimeric Structure Of A Hera Helicase Fragment Inclu | 2e-12 | ||
| 2rb4_A | 175 | Crystal Structure Of The Helicase Domain Of Human D | 1e-11 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 4e-10 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 4e-10 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 4e-10 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 5e-10 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 5e-10 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 5e-10 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 5e-10 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 1e-09 | ||
| 1fuk_A | 165 | Crystal Structure Of The Carboxy Terminal Domain Of | 1e-09 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 1e-09 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 1e-08 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 1e-08 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 1e-08 | ||
| 4db2_A | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 2e-08 | ||
| 4db4_A | 256 | Mss116p Dead-Box Helicase Domain 2 Bound To A Chima | 2e-08 | ||
| 4db2_C | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 2e-08 | ||
| 1t5i_A | 172 | Crystal Structure Of The C-Terminal Domain Of Uap56 | 2e-07 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 3e-07 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 3e-07 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 3e-07 | ||
| 4gl2_A | 699 | Structural Basis For Dsrna Duplex Backbone Recognit | 1e-04 |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
|
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 | Back alignment and structure |
| >pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 | Back alignment and structure |
| >pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 | Back alignment and structure |
| >pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 | Back alignment and structure |
| >pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 | Back alignment and structure |
| >pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 | Back alignment and structure |
| >pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 | Back alignment and structure |
| >pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 251 | |||
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 5e-38 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 6e-33 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 6e-31 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 9e-31 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 2e-30 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 4e-30 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 4e-30 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 4e-30 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 6e-30 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 2e-29 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 2e-29 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 2e-29 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 3e-29 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 4e-29 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 8e-29 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 8e-29 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 7e-28 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 2e-27 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 3e-27 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 7e-27 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 7e-27 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 7e-27 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-26 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 6e-26 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 2e-17 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 2e-15 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 2e-09 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 8e-09 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 5e-08 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 1e-07 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 1e-07 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 2e-07 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 3e-07 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 7e-04 |
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 | Back alignment and structure |
|---|
Score = 129 bits (328), Expect = 5e-38
Identities = 41/106 (38%), Positives = 61/106 (57%)
Query: 2 TVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAAR 61
++VF + V + L AGI++ Y+ ++ R + G++ VLV TDVAAR
Sbjct: 33 SIVFVRKRERVHELANWLREAGINNCYLEGEMVQGKRNEAIKRLTEGRVNVLVATDVAAR 92
Query: 62 GIDIPSLDAVINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSSDE 107
GIDIP + V N++ P ++HR+GR ARAGR G A SLV + +
Sbjct: 93 GIDIPDVSHVFNFDMPRSGDTYLHRIGRTARAGRKGTAISLVEAHD 138
|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 251 | |||
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 99.97 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 99.97 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.97 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 99.97 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.97 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.96 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.96 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.96 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.92 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.95 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.95 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.94 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.94 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.94 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.93 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.93 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.93 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.93 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.93 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.92 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.92 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.91 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.91 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.91 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.9 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.89 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.88 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.88 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.88 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.88 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.87 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.87 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.87 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.87 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.86 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.86 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.86 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.86 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.85 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.85 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.85 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.84 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.84 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.84 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.83 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.83 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.83 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.83 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.81 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.81 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.81 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.81 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.8 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.8 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.8 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.8 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.8 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.79 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.79 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.78 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.78 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.77 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.76 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.76 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.75 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.74 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.71 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.66 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.64 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.48 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.51 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 97.98 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 97.65 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 97.3 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 96.31 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 96.29 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 95.75 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 94.24 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 94.21 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 94.1 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 93.68 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 93.39 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 92.87 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 92.69 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 91.94 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 91.81 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 91.39 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 90.97 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 90.95 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 90.79 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 89.87 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 89.3 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 88.67 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 88.43 | |
| 2l82_A | 162 | Designed protein OR32; structural genomics, northe | 88.27 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 88.02 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 87.69 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 86.57 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 83.89 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 83.7 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 83.68 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 83.66 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 83.41 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 81.88 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 81.8 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 81.37 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 80.44 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 80.17 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 80.13 |
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
Probab=99.97 E-value=3.7e-31 Score=211.92 Aligned_cols=126 Identities=35% Similarity=0.499 Sum_probs=122.1
Q ss_pred CEEEEcCcHHHHHHHHHHHHhCCCcEEEEcCCCCHHHHHHHHHHHhcCCceEEEeccccccccccccccEEEEecCCCCh
Q psy18034 1 MTVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAARGIDIPSLDAVINYNFPCKA 80 (251)
Q Consensus 1 k~iIF~~t~~~~~~l~~~L~~~~~~~~~i~g~~~~~~r~~~~~~F~~g~~~iLv~Td~~~~Gldi~~v~~VI~~d~P~~~ 80 (251)
|+||||+|+.+++.+++.|...|+.+..+||+|++.+|..+++.|++|+.+|||||+++++|+|+|++++||+||+|+++
T Consensus 37 ~~lVF~~~~~~~~~l~~~L~~~~~~~~~~hg~~~~~~r~~~~~~f~~g~~~vlv~T~~~~~Gld~~~~~~Vi~~~~p~~~ 116 (163)
T 2hjv_A 37 SCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEK 116 (163)
T ss_dssp SEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEECGGGTTTCCCSCCSEEEESSCCSSH
T ss_pred cEEEEECCHHHHHHHHHHHHHcCCcEEEEeCCCCHHHHHHHHHHHHcCCCeEEEECChhhcCCchhcCCEEEEeCCCCCH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHhhhcccCCCCceEEEEecCccHHHHHHHHHHhCCCCeecc
Q psy18034 81 KLFVHRVGRCARAGRSGVAYSLVSSDELCYYLDLLLFLGRKPVLAD 126 (251)
Q Consensus 81 ~~y~qr~GR~gR~g~~g~~i~l~~~~e~~~~~~i~~~l~~~~~~~~ 126 (251)
..|+||+||+||.|+.|.+++++++.+..++..++..++.+++..+
T Consensus 117 ~~~~qr~GR~~R~g~~g~~~~~~~~~~~~~~~~i~~~~~~~~~~~~ 162 (163)
T 2hjv_A 117 ESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKIE 162 (163)
T ss_dssp HHHHHHTTTSSCTTCCEEEEEEECGGGHHHHHHHHHHHTSCCEECC
T ss_pred HHHHHhccccCcCCCCceEEEEecHHHHHHHHHHHHHHCCCcCccC
Confidence 9999999999999999999999999999999999999998887543
|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 251 | ||||
| d1a1va2 | 299 | c.37.1.14 (A:326-624) HCV helicase domain {Human h | 7e-23 | |
| d1fuka_ | 162 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 3e-17 | |
| d1wp9a2 | 286 | c.37.1.19 (A:201-486) putative ATP-dependent RNA h | 7e-17 | |
| d1gkub2 | 248 | c.37.1.16 (B:251-498) Helicase-like "domain" of re | 2e-14 | |
| d2j0sa2 | 168 | c.37.1.19 (A:244-411) Probable ATP-dependent RNA h | 7e-13 | |
| d1hv8a2 | 155 | c.37.1.19 (A:211-365) Putative DEAD box RNA helica | 7e-12 | |
| d1jr6a_ | 138 | c.37.1.14 (A:) HCV helicase domain {Human hepatiti | 3e-11 | |
| d1t5la2 | 181 | c.37.1.19 (A:415-595) Nucleotide excision repair e | 9e-11 | |
| d1oywa3 | 200 | c.37.1.19 (A:207-406) RecQ helicase domain {Escher | 2e-10 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 7e-10 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 1e-09 | |
| d2rb4a1 | 168 | c.37.1.19 (A:307-474) ATP-dependent RNA helicase D | 2e-09 | |
| d1c4oa2 | 174 | c.37.1.19 (A:410-583) Nucleotide excision repair e | 4e-08 | |
| d1s2ma2 | 171 | c.37.1.19 (A:252-422) Putative ATP-dependent RNA h | 6e-06 | |
| d2p6ra4 | 201 | c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob | 1e-05 | |
| d1t5ia_ | 168 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 1e-04 | |
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 8e-04 | |
| d1tf5a4 | 175 | c.37.1.19 (A:396-570) Translocation ATPase SecA, n | 0.001 |
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: HCV helicase domain species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]
Score = 92.7 bits (230), Expect = 7e-23
Identities = 21/117 (17%), Positives = 37/117 (31%), Gaps = 14/117 (11%)
Query: 2 TVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINA----------AKFQTGKIR 51
++F +K + + L GI++ Y LD + + TG
Sbjct: 39 HLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVATDALMTGFTGDFD 98
Query: 52 VLVVTDVAARGIDIPSLDA---VINYNFPCKAKLFVHRVGRCARAGRSGVAYSLVSS 105
++ + SLD + P A R GR R G+ G+ +
Sbjct: 99 SVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGR-GKPGIYRFVAPG 154
|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 251 | |||
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 100.0 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 100.0 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 100.0 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 100.0 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 100.0 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.97 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.97 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.96 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.95 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.93 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.91 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.87 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.86 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.85 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.83 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.82 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.73 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.66 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.64 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.61 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.55 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 99.3 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 98.58 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.28 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.74 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 93.73 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 93.33 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 88.81 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 86.95 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 85.84 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 81.27 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 80.63 |
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Initiation factor 4a species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=2.4e-35 Score=234.81 Aligned_cols=128 Identities=32% Similarity=0.535 Sum_probs=119.7
Q ss_pred CEEEEcCcHHHHHHHHHHHHhCCCcEEEEcCCCCHHHHHHHHHHHhcCCceEEEeccccccccccccccEEEEecCCCCh
Q psy18034 1 MTVVFTATKYHVEYVHKILGLAGISSTYIYSDLDPTARKINAAKFQTGKIRVLVVTDVAARGIDIPSLDAVINYNFPCKA 80 (251)
Q Consensus 1 k~iIF~~t~~~~~~l~~~L~~~~~~~~~i~g~~~~~~r~~~~~~F~~g~~~iLv~Td~~~~Gldi~~v~~VI~~d~P~~~ 80 (251)
|+||||+|+.+++++++.|...|+.+..+||+|++.+|..+++.|+.|+.++|||||+++||+|+|++++|||||+|+++
T Consensus 29 k~iIF~~s~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~l~~f~~~~~~iLv~Tdv~~rGiDi~~v~~VI~~d~P~~~ 108 (162)
T d1fuka_ 29 QAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANK 108 (162)
T ss_dssp CEEEEESSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEEEGGGTTTCCCCSCSEEEESSCCSSG
T ss_pred cEEEEEEEEchHHHHHHHHhhcCceEEEeccCCchhhHHHHHHHHhhcccceeeccccccccccCCCceEEEEeccchhH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHhhhcccCCCCceEEEEecCccHHHHHHHHHHhCCCCeeccCC
Q psy18034 81 KLFVHRVGRCARAGRSGVAYSLVSSDELCYYLDLLLFLGRKPVLADDS 128 (251)
Q Consensus 81 ~~y~qr~GR~gR~g~~g~~i~l~~~~e~~~~~~i~~~l~~~~~~~~~~ 128 (251)
+.|+||+||+||.|+.|.+++|+++.|...+..++..++.+++.+|..
T Consensus 109 ~~yihR~GR~gR~g~~g~~i~~~~~~d~~~~~~i~~~~~~~~~~ip~~ 156 (162)
T d1fuka_ 109 ENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSD 156 (162)
T ss_dssp GGGGGSSCSCC-----CEEEEEEETTTHHHHHHHHHHSSCCCEECCSC
T ss_pred HHHHhhccccccCCCccEEEEEcCHHHHHHHHHHHHHHcCcCCCCChH
Confidence 999999999999999999999999999999999999999999888753
|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|