Diaphorina citri psyllid: psy18038


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
cccHHHHHHHHHHHHHHHHHcccccccEEEEEEEHHHHHHHHccccccccccEEEcccccccccccccccccccccccccEEEEcccccccccccccccccccEEECccccccccccccccccccccccEEccccccccHHHHHcc
*ESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipase member H Hydrolyzes specifically phosphatidic acid (PA) to produce lysophosphatidic acid (LPA).confidentQ8CIV3
Lipase member H Hydrolyzes specifically phosphatidic acid (PA) to produce lysophosphatidic acid (LPA).confidentQ32PY2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0004620 [MF]phospholipase activityprobableGO:0016787, GO:0003674, GO:0016298, GO:0016788, GO:0003824
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0017129 [MF]triglyceride bindingprobableGO:0003674, GO:0008289, GO:0005488
GO:0004465 [MF]lipoprotein lipase activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0016298
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0034372 [BP]very-low-density lipoprotein particle remodelingprobableGO:0071825, GO:0071827, GO:0044707, GO:0034367, GO:0034368, GO:0034369, GO:0034370, GO:0016043, GO:0008150, GO:0043933, GO:0032501, GO:0097006, GO:0071840, GO:0065007, GO:0050789, GO:0044699
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0034185 [MF]apolipoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0019433 [BP]triglyceride catabolic processprobableGO:0044238, GO:1901575, GO:0009987, GO:0006629, GO:0006641, GO:0009056, GO:0006639, GO:0006638, GO:0044710, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0044242, GO:0008150, GO:0008152, GO:0046464, GO:0044255, GO:0046486, GO:0046503, GO:0046461
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0070328 [BP]triglyceride homeostasisprobableGO:0042592, GO:0048878, GO:0055088, GO:0065007, GO:0008150, GO:0065008, GO:0055090
GO:0009395 [BP]phospholipid catabolic processprobableGO:0044238, GO:0006644, GO:0046434, GO:0009987, GO:1901575, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0006796, GO:0044710, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044242, GO:0009056, GO:0044255, GO:0006629
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0004806 [MF]triglyceride lipase activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0016298

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W52, chain X
Confidence level:very confident
Coverage over the Query: 6-144
View the alignment between query and template
View the model in PyMOL