Psyllid ID: psy18038

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
cccHHHHHHHHHHHHHHHHHcccccccEEEEEEEHHHHHHHHccccccccccEEEcccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccccccccccccccEEccccccccHHHHHcc
cccHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHccccccccccEEEEcEEccEccccccccccccccHHHccEEEEEcccccccccccccccccccEEEEcccccccccccccccHcccccHHHHHHcccccEEEEEEcc
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSnlrtmfpgldpagplfesqdprsrldssdaqFVDVIHsngenlilgglgswqplghvdfypnggrmqkgctnlFVGAVSDILWFQFSDHLRNLGWKVLT
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
************SIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGL*********************QFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKV**
*ESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFES*********SDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
**SAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESAKSLVEQASSIFRLYVQSGRGFSRVVLIYSACSSFLILSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKVLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
Q9BDJ4 452 Lipase member H OS=Orycto yes N/A 0.397 0.128 0.619 8e-17
Q6XZB0 460 Lipase member I OS=Homo s yes N/A 0.397 0.126 0.619 1e-16
Q32PY2 451 Lipase member H OS=Rattus yes N/A 0.527 0.170 0.512 2e-16
Q8WWY8 451 Lipase member H OS=Homo s no N/A 0.513 0.166 0.5 1e-15
Q5XGE9 460 Lipase member H OS=Xenopu yes N/A 0.397 0.126 0.587 1e-15
Q8CIV3 451 Lipase member H OS=Mus mu yes N/A 0.458 0.148 0.541 2e-15
Q6PA23 460 Lipase member H-A OS=Xeno N/A N/A 0.397 0.126 0.571 2e-15
Q641F6 460 Lipase member H-B OS=Xeno N/A N/A 0.397 0.126 0.571 3e-15
Q17RR3 467 Pancreatic lipase-related no N/A 0.568 0.177 0.431 5e-15
P54317 469 Pancreatic lipase-related no N/A 0.602 0.187 0.416 1e-14
>sp|Q9BDJ4|LIPH_RABIT Lipase member H OS=Oryctolagus cuniculus GN=LIPH PE=2 SV=1 Back     alignment and function desciption
 Score = 85.9 bits (211), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/63 (61%), Positives = 46/63 (73%), Gaps = 5/63 (7%)

Query: 55  GLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQ 114
           GLDPAGPLF  + P+ RLD SDAQFVDVIHS+ +      LG  +PLG++DFYPNGG  Q
Sbjct: 176 GLDPAGPLFNGKPPQDRLDPSDAQFVDVIHSDTD-----ALGYKEPLGNIDFYPNGGVDQ 230

Query: 115 KGC 117
            GC
Sbjct: 231 PGC 233
Hydrolyzes specifically phosphatidic acid (PA) to produce lysophosphatidic acid (LPA).
Oryctolagus cuniculus (taxid: 9986)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q6XZB0|LIPI_HUMAN Lipase member I OS=Homo sapiens GN=LIPI PE=1 SV=2 Back     alignment and function description
>sp|Q32PY2|LIPH_RAT Lipase member H OS=Rattus norvegicus GN=Liph PE=2 SV=1 Back     alignment and function description
>sp|Q8WWY8|LIPH_HUMAN Lipase member H OS=Homo sapiens GN=LIPH PE=1 SV=1 Back     alignment and function description
>sp|Q5XGE9|LIPH_XENTR Lipase member H OS=Xenopus tropicalis GN=liph PE=2 SV=1 Back     alignment and function description
>sp|Q8CIV3|LIPH_MOUSE Lipase member H OS=Mus musculus GN=Liph PE=2 SV=2 Back     alignment and function description
>sp|Q6PA23|LIPHA_XENLA Lipase member H-A OS=Xenopus laevis GN=liph-a PE=2 SV=1 Back     alignment and function description
>sp|Q641F6|LIPHB_XENLA Lipase member H-B OS=Xenopus laevis GN=liph-b PE=2 SV=1 Back     alignment and function description
>sp|Q17RR3|LIPR3_HUMAN Pancreatic lipase-related protein 3 OS=Homo sapiens GN=PNLIPRP3 PE=2 SV=2 Back     alignment and function description
>sp|P54317|LIPR2_HUMAN Pancreatic lipase-related protein 2 OS=Homo sapiens GN=PNLIPRP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
242004815 935 Pancreatic triacylglycerol lipase precur 0.520 0.081 0.907 7e-39
270013516 924 hypothetical protein TcasGA2_TC012121 [T 0.520 0.082 0.907 6e-38
189240829 926 PREDICTED: similar to CG6847 CG6847-PA [ 0.520 0.082 0.907 6e-38
193605967 877 PREDICTED: hypothetical protein LOC10015 0.520 0.086 0.855 7e-36
332023895 1051 Pancreatic lipase-related protein 1 [Acr 0.520 0.072 0.815 2e-34
345483531 1037 PREDICTED: hypothetical protein LOC10011 0.520 0.073 0.855 3e-34
170033742 819 lipase [Culex quinquefasciatus] gi|16787 0.520 0.092 0.828 5e-34
307175252 1051 Pancreatic lipase-related protein 1 [Cam 0.520 0.072 0.802 6e-34
195132045 978 GI14674 [Drosophila mojavensis] gi|19390 0.520 0.077 0.828 1e-33
195040161 991 GH12446 [Drosophila grimshawi] gi|193900 0.520 0.076 0.828 1e-33
>gi|242004815|ref|XP_002423272.1| Pancreatic triacylglycerol lipase precursor, putative [Pediculus humanus corporis] gi|212506274|gb|EEB10534.1| Pancreatic triacylglycerol lipase precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 69/76 (90%), Positives = 75/76 (98%)

Query: 55  GLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQ 114
           GLDPAGPLFESQDP++RLD +DA+FVDVIHSNGENLILGGLGSWQP+GHVDFYPNGGRMQ
Sbjct: 194 GLDPAGPLFESQDPKARLDETDAKFVDVIHSNGENLILGGLGSWQPMGHVDFYPNGGRMQ 253

Query: 115 KGCTNLFVGAVSDILW 130
           KGCTNLFVGAVSDI+W
Sbjct: 254 KGCTNLFVGAVSDIIW 269

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270013516|gb|EFA09964.1| hypothetical protein TcasGA2_TC012121 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240829|ref|XP_001812059.1| PREDICTED: similar to CG6847 CG6847-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193605967|ref|XP_001944556.1| PREDICTED: hypothetical protein LOC100158740 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332023895|gb|EGI64115.1| Pancreatic lipase-related protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345483531|ref|XP_001599427.2| PREDICTED: hypothetical protein LOC100114392 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170033742|ref|XP_001844735.1| lipase [Culex quinquefasciatus] gi|167874812|gb|EDS38195.1| lipase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307175252|gb|EFN65298.1| Pancreatic lipase-related protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195132045|ref|XP_002010454.1| GI14674 [Drosophila mojavensis] gi|193908904|gb|EDW07771.1| GI14674 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195040161|ref|XP_001991014.1| GH12446 [Drosophila grimshawi] gi|193900772|gb|EDV99638.1| GH12446 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
FB|FBgn0030884 1000 CG6847 [Drosophila melanogaste 0.520 0.076 0.815 1e-31
UNIPROTKB|F1NC89204 F1NC89 "Uncharacterized protei 0.582 0.416 0.470 1.4e-16
UNIPROTKB|F1PG57 451 LIPH "Uncharacterized protein" 0.527 0.170 0.5 9.3e-16
RGD|1592849 451 Liph "lipase, member H" [Rattu 0.513 0.166 0.525 9.3e-16
UNIPROTKB|Q6XZB0 460 LIPI "Lipase member I" [Homo s 0.438 0.139 0.585 9.8e-16
UNIPROTKB|F1SFK2 371 LIPH "Uncharacterized protein" 0.527 0.207 0.488 1.1e-15
UNIPROTKB|F1P2G7 436 LIPH "Uncharacterized protein" 0.520 0.174 0.517 2.3e-15
MGI|MGI:2388029 451 Liph "lipase, member H" [Mus m 0.794 0.257 0.367 4.2e-15
UNIPROTKB|Q8WWY8 451 LIPH "Lipase member H" [Homo s 0.527 0.170 0.5 5.4e-15
FB|FBgn0029831 540 CG5966 [Drosophila melanogaste 0.486 0.131 0.535 6.3e-15
FB|FBgn0030884 CG6847 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 1.0e-31, P = 1.0e-31
 Identities = 62/76 (81%), Positives = 72/76 (94%)

Query:    55 GLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQ 114
             GLDPAGPLFE+Q P+ RLDSSDA+FVDVIHSNGENLILGGLGSW+P+GHVD+YPNGGR+Q
Sbjct:   296 GLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWRPMGHVDYYPNGGRVQ 355

Query:   115 KGCTNLFVGAVSDILW 130
              GC+NLFVGAV+D +W
Sbjct:   356 TGCSNLFVGAVTDFIW 371
GO:0004806 "triglyceride lipase activity" evidence=ISS
GO:0006629 "lipid metabolic process" evidence=IEA
UNIPROTKB|F1NC89 F1NC89 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PG57 LIPH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1592849 Liph "lipase, member H" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6XZB0 LIPI "Lipase member I" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFK2 LIPH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2G7 LIPH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2388029 Liph "lipase, member H" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WWY8 LIPH "Lipase member H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0029831 CG5966 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CIV3LIPH_MOUSE3, ., 1, ., 1, ., -0.54160.45890.1485yesN/A
Q32PY2LIPH_RAT3, ., 1, ., 1, ., -0.51210.52730.1707yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
cd00707275 cd00707, Pancreat_lipase_like, Pancreatic lipase-l 1e-34
pfam00151329 pfam00151, Lipase, Lipase 4e-24
TIGR03230 442 TIGR03230, lipo_lipase, lipoprotein lipase 3e-18
cd00741153 cd00741, Lipase, Lipase 6e-11
>gnl|CDD|238363 cd00707, Pancreat_lipase_like, Pancreatic lipase-like enzymes Back     alignment and domain information 
 Score =  121 bits (305), Expect = 1e-34
 Identities = 46/84 (54%), Positives = 50/84 (59%), Gaps = 10/84 (11%)

Query: 55  GLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQ 114
           GLDPAGPLF   DP  RLD SDAQFVDVIH++G     G LG  QP+GH DFYPNGGR Q
Sbjct: 142 GLDPAGPLFSGADPEDRLDPSDAQFVDVIHTDG-----GLLGFSQPIGHADFYPNGGRDQ 196

Query: 115 KGCTNLFVGAVSDILWFQFSDHLR 138
            GC    +        F    H R
Sbjct: 197 PGCPKDIL-----SSDFVACSHQR 215

Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. Length = 275
>gnl|CDD|215752 pfam00151, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|132274 TIGR03230, lipo_lipase, lipoprotein lipase Back     alignment and domain information
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 100.0
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 100.0
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 100.0
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.03
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 96.02
PLN02824294 hydrolase, alpha/beta fold family protein 95.84
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 94.94
PRK00870302 haloalkane dehalogenase; Provisional 94.92
PRK10673255 acyl-CoA esterase; Provisional 94.4
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.33
PLN02965255 Probable pheophorbidase 94.22
PRK03592295 haloalkane dehalogenase; Provisional 93.25
TIGR03611257 RutD pyrimidine utilization protein D. This protei 93.21
PLN02679360 hydrolase, alpha/beta fold family protein 93.09
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 92.75
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 92.02
PRK08775343 homoserine O-acetyltransferase; Provisional 91.73
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 91.63
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 91.54
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 91.54
PLN02578354 hydrolase 91.46
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 91.18
PRK10349256 carboxylesterase BioH; Provisional 91.06
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 90.43
PRK11460232 putative hydrolase; Provisional 90.43
PRK03204286 haloalkane dehalogenase; Provisional 89.78
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 89.54
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 89.34
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 89.26
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 89.24
PLN02211273 methyl indole-3-acetate methyltransferase 88.75
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 88.34
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 87.99
PLN03084383 alpha/beta hydrolase fold protein; Provisional 87.75
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 87.74
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 87.41
PLN00021313 chlorophyllase 87.16
PRK10749330 lysophospholipase L2; Provisional 87.12
PLN02894 402 hydrolase, alpha/beta fold family protein 86.88
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 86.74
PLN02385349 hydrolase; alpha/beta fold family protein 86.72
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 85.79
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 85.7
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 84.92
PRK10566249 esterase; Provisional 84.63
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 84.04
PHA02857276 monoglyceride lipase; Provisional 82.99
smart0003734 CNX Connexin homologues. Connexin channels partici 82.6
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 82.09
PLN02298330 hydrolase, alpha/beta fold family protein 81.96
PRK06765 389 homoserine O-acetyltransferase; Provisional 81.13
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 80.6
PRK05077414 frsA fermentation/respiration switch protein; Revi 80.45
PRK06489360 hypothetical protein; Provisional 80.19
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 80.07
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information 
Probab=100.00  E-value=5.1e-45  Score=310.45  Aligned_cols=135  Identities=39%  Similarity=0.623  Sum_probs=99.5

Q ss_pred             HHHHHHHHHHHHHH-HcCCCCccEEEE-eehhhHHHHH-hhhhcC-CcCCceeeecCCccCCccCCCCccccCCCCCeEE
Q psy18038          6 SLVEQASSIFRLYV-QSGRGFSRVVLI-YSACSSFLIL-SNTFYS-NLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVD   81 (146)
Q Consensus         6 ~~~~~~~~~~~~l~-~~G~~~~~v~li-~SlGahia~~-~~~~~~-~~lgrItgLDPA~P~F~~~~~~~rL~~~DA~fVd   81 (146)
                      .+.+++.+|+++|. +.|++++++||| ||||||||++ |+++.+ ++|+||||||||+|+|+..++..|||++||+|||
T Consensus       129 ~vg~~la~~l~~L~~~~g~~~~~ihlIGhSLGAHvaG~aG~~~~~~~ki~rItgLDPAgP~F~~~~~~~rL~~~DA~fVd  208 (331)
T PF00151_consen  129 LVGRQLAKFLSFLINNFGVPPENIHLIGHSLGAHVAGFAGKYLKGGGKIGRITGLDPAGPLFENNPPSERLDKSDAKFVD  208 (331)
T ss_dssp             HHHHHHHHHHHHHHHHH---GGGEEEEEETCHHHHHHHHHHHTTT---SSEEEEES-B-TTTTTS-TTTS--GGGSSEEE
T ss_pred             HHHHHHHHHHHHHHhhcCCChhHEEEEeeccchhhhhhhhhhccCcceeeEEEecCcccccccCCChhHhhhccCCceEE
Confidence            34556666777777 679999999999 9999999885 566655 5779999999999999998888999999999999


Q ss_pred             EEecCCcccccccCCCCCCCCceeEEcCCCCCCCCCCCccchhhhhhhHhhhcccccccccee
Q psy18038         82 VIHSNGENLILGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSDILWFQFSDHLRNLGWKV  144 (146)
Q Consensus        82 vIHT~~~~l~~g~lG~~~~~Gh~DFypNGG~~QPGC~~~~~~~~~~~~~~~~c~H~rs~~~~~  144 (146)
                      |||||+..+..+.+|+.+|+||+|||||||..||||......    +.-...|||.||+.|++
T Consensus       209 vIHT~~~~~~~~~~G~~~~~Gh~DFYpNgG~~QPGC~~~~~~----~~~~~~CsH~ra~~~f~  267 (331)
T PF00151_consen  209 VIHTNAGTLPGGGLGTSEPIGHVDFYPNGGRRQPGCGNDSLE----LTRFISCSHMRAVEYFA  267 (331)
T ss_dssp             EE-SSES-HHH-SSBESS--SSEEEEETTTTS-TTSSS-CHT----TCSHHHHHHHHHHHHHH
T ss_pred             EEEcCCccccCCccccccccccceeecCCCccCCCCcccccc----ceecchhhhHHHHHHHH
Confidence            999999766667899999999999999999999999876531    11245899999999875

1.1.3 from EC) are lipolytic enzymes that hydrolyse ester linkages of triglycerides []. Lipases are widely distributed in animals, plants and prokaryotes. At least three tissue-specific isozymes exist in higher vertebrates, pancreatic, hepatic and gastric/lingual. These lipases are closely related to each other and to lipoprotein lipase (3.1.1.34 from EC), which hydrolyses triglycerides of chylomicrons and very low density lipoproteins (VLDL) []. The most conserved region in all these proteins is centred around a serine residue which has been shown [] to participate, with an histidine and an aspartic acid residue, in a charge relay system. Such a region is also present in lipases of prokaryotic origin and in lecithin-cholesterol acyltransferase (2.3.1.43 from EC) (LCAT) [], which catalyzes fatty acid transfer between phosphatidylcholine and cholesterol.; PDB: 1LPB_B 1LPA_B 1N8S_A 1GPL_A 1W52_X 2PVS_B 2OXE_B 1BU8_A 2PPL_A 1ETH_A ....
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>smart00037 CNX Connexin homologues Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
2oxe_A 466 Structure Of The Human Pancreatic Lipase-Related Pr 5e-16
2pvs_A 452 Structure Of Human Pancreatic Lipase Related Protei 1e-15
1lpa_B 449 Interfacial Activation Of The Lipase-Procolipase Co 2e-14
1eth_A 448 Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 2e-14
1w52_X 452 Crystal Structure Of A Proteolyzed Form Of Pancreat 4e-14
1hpl_A 449 Horse Pancreatic Lipase. The Crystal Structure At 2 7e-14
1bu8_A 452 Rat Pancreatic Lipase Related Protein 2 Length = 45 7e-14
2ppl_A 485 Human Pancreatic Lipase-Related Protein 1 Length = 7e-14
1rp1_A 450 Dog Pancreatic Lipase Related Protein 1 Length = 45 1e-12
1gpl_A 432 Rp2 Lipase Length = 432 2e-12
>pdb|2OXE|A Chain A, Structure Of The Human Pancreatic Lipase-Related Protein 2 Length = 466 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
Query: 55  GLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILG-GLGSWQPLGHVDFYPNGGRM 113
           GLDPAGP F+ +    RLD SDA FVDVIH++   ++   G G  Q +GH+DF+PNGG+ 
Sbjct: 178 GLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKE 237
Query: 114 QKGCTNLFVGAVSDI--LW-----FQFSDHLRNLGW 142
             GC    +  ++DI  +W     F   +HLR+  +
Sbjct: 238 MPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEY 273
>pdb|2PVS|A Chain A, Structure Of Human Pancreatic Lipase Related Protein 2 Mutant N336q Length = 452 Back     alignment and structure
>pdb|1LPA|B Chain B, Interfacial Activation Of The Lipase-Procolipase Complex By Mixed Micelles Revealed By X-Ray Crystallography Length = 449 Back     alignment and structure
>pdb|1ETH|A Chain A, Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 Back     alignment and structure
>pdb|1W52|X Chain X, Crystal Structure Of A Proteolyzed Form Of Pancreatic Lipase Related Protein 2 From Horse Length = 452 Back     alignment and structure
>pdb|1HPL|A Chain A, Horse Pancreatic Lipase. The Crystal Structure At 2.3 Angstroms Resolution Length = 449 Back     alignment and structure
>pdb|1BU8|A Chain A, Rat Pancreatic Lipase Related Protein 2 Length = 452 Back     alignment and structure
>pdb|2PPL|A Chain A, Human Pancreatic Lipase-Related Protein 1 Length = 485 Back     alignment and structure
>pdb|1RP1|A Chain A, Dog Pancreatic Lipase Related Protein 1 Length = 450 Back     alignment and structure
>pdb|1GPL|A Chain A, Rp2 Lipase Length = 432 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 7e-27
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 3e-26
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 2e-25
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 5e-25
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 6e-25
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Length = 452 Back     alignment and structure
 Score =  102 bits (256), Expect = 7e-27
 Identities = 37/92 (40%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 55  GLDPAGPLFESQDPRSRLDSSDAQFVDVIHSNGENLILG-GLGSWQPLGHVDFYPNGGRM 113
           GLDPA P F+      RLD SDAQFVDVIH++   ++   G G  Q +GH+DF+PNGG+ 
Sbjct: 176 GLDPAEPCFQDASEEVRLDPSDAQFVDVIHTDASPMLPSLGFGMSQKVGHMDFFPNGGKQ 235

Query: 114 QKGCTNLFVGAVSDILWFQFS-------DHLR 138
             GC         DI             +HL+
Sbjct: 236 MPGCKRSSFSTFIDINGIWQGAQDYLACNHLK 267
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Length = 450 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Length = 452 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Length = 449 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Length = 432 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.98
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.98
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.96
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.96
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.93
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 96.53
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 96.28
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.26
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 96.21
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 96.16
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.09
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 96.05
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.01
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 95.97
1iup_A282 META-cleavage product hydrolase; aromatic compound 95.97
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 95.95
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 95.95
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 95.95
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 95.89
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 95.84
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 95.81
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 95.76
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 95.71
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.69
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 95.66
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 95.61
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 95.61
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.56
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 95.54
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 95.52
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 95.49
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 95.49
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 95.48
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 95.42
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 95.42
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 95.37
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 95.35
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.35
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 95.3
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 95.28
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 95.28
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 95.23
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 95.19
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.18
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 95.15
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 95.13
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 95.12
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 95.12
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 95.11
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 95.08
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 95.08
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.08
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 95.03
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 94.97
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 94.83
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 94.8
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 94.76
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.74
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 94.73
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 94.51
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 94.37
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 94.35
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 94.34
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 94.3
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 94.3
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 94.28
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 94.24
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 94.2
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 94.14
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 94.13
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 94.12
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 94.01
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 93.95
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 93.93
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 93.92
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 93.91
3llc_A270 Putative hydrolase; structural genomics, joint cen 93.83
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 93.73
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 93.67
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.66
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 93.6
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 93.6
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 93.55
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 93.5
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 93.39
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 93.31
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 93.22
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 93.18
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 93.13
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 93.1
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 93.08
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 92.83
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 92.8
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 92.77
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 92.76
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 92.5
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 92.43
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 92.31
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 92.26
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 92.12
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 91.86
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 91.83
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 91.75
4f21_A246 Carboxylesterase/phospholipase family protein; str 91.72
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 91.72
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 91.71
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 90.9
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 91.53
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 91.39
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 91.37
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 91.35
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 91.12
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 90.9
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 90.78
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 90.76
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 90.74
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 90.35
3h04_A275 Uncharacterized protein; protein with unknown func 90.23
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 90.04
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 89.99
1kez_A300 Erythronolide synthase; polyketide synthase, modul 89.81
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 89.79
3bjr_A283 Putative carboxylesterase; structural genomics, jo 89.77
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 89.54
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 89.38
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 89.27
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 89.25
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 89.15
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 89.02
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 88.89
1vkh_A273 Putative serine hydrolase; structural genomics, jo 88.81
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 88.67
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 88.62
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 88.62
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 88.55
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 88.5
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 88.34
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 88.32
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 88.22
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 88.19
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 88.02
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 87.96
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 87.94
3tej_A329 Enterobactin synthase component F; nonribosomal pe 87.92
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 87.8
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 87.55
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 87.39
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 86.92
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 86.9
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 86.0
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 85.64
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 85.56
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 85.15
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 84.93
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 84.91
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 84.81
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 84.65
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 84.52
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 84.07
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 83.99
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 83.75
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 83.44
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 83.44
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 83.27
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 82.93
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 82.66
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 82.61
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 82.58
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 82.41
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 81.93
3lp5_A250 Putative cell surface hydrolase; structural genom 81.91
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 81.59
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 81.42
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 80.81
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 80.13
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
Probab=99.98  E-value=6.7e-33  Score=241.70  Aligned_cols=137  Identities=32%  Similarity=0.482  Sum_probs=108.0

Q ss_pred             HHHHHHHHHHHHH-HcCCCCccEEEE-eehhhHHHH-HhhhhcCCcCCceeeecCCccCCccCCCCccccCCCCCeEEEE
Q psy18038          7 LVEQASSIFRLYV-QSGRGFSRVVLI-YSACSSFLI-LSNTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVDVI   83 (146)
Q Consensus         7 ~~~~~~~~~~~l~-~~G~~~~~v~li-~SlGahia~-~~~~~~~~~lgrItgLDPA~P~F~~~~~~~rL~~~DA~fVdvI   83 (146)
                      +.+.+..+++.|. +.|++++++||| ||+|||+|+ ++.++.++ ++||++||||+|.|...++..||+++||+|||+|
T Consensus       125 v~~~la~ll~~L~~~~g~~~~~v~LIGhSlGg~vA~~~a~~~p~~-v~~iv~Ldpa~p~f~~~~~~~rl~~~da~~vd~I  203 (449)
T 1hpl_A          125 VGAEVAYLVGVLQSSFDYSPSNVHIIGHSLGSHAAGEAGRRTNGA-VGRITGLDPAEPCFQGTPELVRLDPSDAQFVDVI  203 (449)
T ss_dssp             HHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHHHHHHHHTTTC-SSEEEEESCBCTTTTTSCTTTSCCGGGSSEEEEE
T ss_pred             HHHHHHHHHHHHHHhcCCCcccEEEEEECHhHHHHHHHHHhcchh-cceeeccCcccccccCCChhhccCcchhhHhhHh
Confidence            3344555566665 468999999999 999999987 45666655 5999999999999998777789999999999999


Q ss_pred             ecCCcccccc-cCCCCCCCCceeEEcCCCCCCCCCCCccchhhhh--hhHh-----hhcccccccccee
Q psy18038         84 HSNGENLILG-GLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSD--ILWF-----QFSDHLRNLGWKV  144 (146)
Q Consensus        84 HT~~~~l~~g-~lG~~~~~Gh~DFypNGG~~QPGC~~~~~~~~~~--~~~~-----~~c~H~rs~~~~~  144 (146)
                      ||++..+..+ ++|+.+|+||+|||||||..||||.......+.+  ..|.     ..|||.||+.|+.
T Consensus       204 ht~~~~~~~~~~~G~~~~~Gh~dfypNgG~~QPgC~~~~~~~~~d~~~~~~~~~~~~~CsH~ra~~~f~  272 (449)
T 1hpl_A          204 HTDIAPFIPNLGFGMSQTAGHLDFFPNGGKEMPGCQKNVLSQIVDIDGIWQGTRDFAACNHLRSYKYYT  272 (449)
T ss_dssp             CSCCSCHHHHCCCBCCSCCSSEEEEETTSSCCTTCCCCCCCSSCCHHHHHTTSSCCCCHHHHHHHHHHH
T ss_pred             hhcchhhhhhcccCcCCCccCeeeccCCCCCCCCCCcccccccccccccccccccCCccCchhHHHHHH
Confidence            9998643222 5799999999999999999999998643222222  1232     5899999999874
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1bu8a2338 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 2e-23
d1rp1a2337 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 2e-22
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 338 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Pancreatic lipase, N-terminal domain
domain: Pancreatic lipase, N-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 91.4 bits (226), Expect = 2e-23
 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 54  PGLDPAGPLFESQDPRSRLDSSDAQFVDVIHSN-GENLILGGLGSWQPLGHVDFYPNGGR 112
            GLDPA P F+      RLD SDA FVDVIH++    +   G G  Q +GH+DF+PNGG+
Sbjct: 175 TGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGK 234

Query: 113 MQKGCTNLFVGAVSDILWF 131
              GC    +  + DI   
Sbjct: 235 EMPGCQKNILSTIVDINGI 253
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 337 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 100.0
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 100.0
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 96.86
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 96.21
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 95.74
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 95.74
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.58
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 95.45
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 95.44
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 94.8
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.73
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 94.67
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 94.55
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 94.27
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 94.27
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 93.8
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 93.66
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 93.27
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 93.21
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 93.07
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 92.92
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 92.54
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 91.83
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 91.38
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 91.24
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 91.07
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 90.03
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 89.95
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 89.6
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 89.47
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 89.15
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 88.39
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 88.38
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 86.98
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 86.91
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 86.89
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 86.17
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 85.72
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 83.11
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 82.87
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 81.18
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 80.23
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Pancreatic lipase, N-terminal domain
domain: Pancreatic lipase, N-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=4.5e-44  Score=303.17  Aligned_cols=139  Identities=31%  Similarity=0.504  Sum_probs=111.2

Q ss_pred             hHHHHHHHHHHHHHHH-cCCCCccEEEE-eehhhHHHHHh-hhhcCCcCCceeeecCCccCCccCCCCccccCCCCCeEE
Q psy18038          5 KSLVEQASSIFRLYVQ-SGRGFSRVVLI-YSACSSFLILS-NTFYSNLRTMFPGLDPAGPLFESQDPRSRLDSSDAQFVD   81 (146)
Q Consensus         5 ~~~~~~~~~~~~~l~~-~G~~~~~v~li-~SlGahia~~~-~~~~~~~lgrItgLDPA~P~F~~~~~~~rL~~~DA~fVd   81 (146)
                      +.+.+++.+|+++|.+ .|++++++||| ||||||+|+.+ +++.++ ++||||||||+|+|+..+++.|||++||+|||
T Consensus       124 ~~Vg~~ia~~i~~l~~~~g~~~~~vhlIGhSLGAhiaG~ag~~l~~k-igrItgLDPA~P~F~~~~~~~rLd~~DA~fVd  202 (338)
T d1bu8a2         124 RVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAGRRLEGH-VGRITGLDPAEPCFQGLPEEVRLDPSDAMFVD  202 (338)
T ss_dssp             HHHHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHHHHHHHHTTTC-SSEEEEESCBCTTTTTSCGGGSCCGGGSSSEE
T ss_pred             HHHHHHHHHHHHHHHHhcCCCcceeEEEeccHHHHHHHHHHHhhccc-cccccccccCcCcccCCchhcCcCcccCCeEE
Confidence            3444555666666654 59999999999 99999998865 566554 59999999999999998888999999999999


Q ss_pred             EEecCCcccc-cccCCCCCCCCceeEEcCCCCCCCCCCCccchhhhh-------hhHhhhcccccccccee
Q psy18038         82 VIHSNGENLI-LGGLGSWQPLGHVDFYPNGGRMQKGCTNLFVGAVSD-------ILWFQFSDHLRNLGWKV  144 (146)
Q Consensus        82 vIHT~~~~l~-~g~lG~~~~~Gh~DFypNGG~~QPGC~~~~~~~~~~-------~~~~~~c~H~rs~~~~~  144 (146)
                      |||||++.+. ..++|+.+|+||+|||||||..||||.........+       ......|||.||+.|+.
T Consensus       203 VIHT~~g~l~~~~~~G~~~p~GhvDFYpNGG~~QPgC~~~~~~~~~~~~~~~~~~~~~~~CsH~ra~~yf~  273 (338)
T d1bu8a2         203 VIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYA  273 (338)
T ss_dssp             EECSCCSCHHHHCCCBCCSCCSSEEEEETTSSCCTTCCCCCCCSCCCHHHHHTTSSCCCCHHHHHHHHHHH
T ss_pred             EEEeCCccccccccCCccCCcCCeeeccCCCccCCCCCcchhhccccccccccccccccccchHHHHHHHH
Confidence            9999986542 135799999999999999999999998765433211       11124799999999874
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure