Diaphorina citri psyllid: psy18046

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-

MGFNDQLGNLSGRFNLVLHLHSDSHHADSNKLDPISHNLNHLDNTDPNDLEISNDLEINDDSASNASSYDYGNHGNKMADLGERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccc

******L*********************************************************************************************TFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGFNDQLGNLSGRFNLVLHLHSDSHHADSNKLDPISHNLNHLDNTDPNDLEISNDLEINDDSASNASSYDYGNHGNKMADLGERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0001755 [BP]	neural crest cell migration	probable	GO:0030154, GO:0048468, GO:0006928, GO:0051674, GO:0001667, GO:0007275, GO:0044699, GO:0014032, GO:0014033, GO:0014031, GO:0048864, GO:0048869, GO:0048513, GO:0016477, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0048731, GO:0060485, GO:0051179, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0008150
GO:0001754 [BP]	eye photoreceptor cell differentiation	probable	GO:0044707, GO:0030154, GO:0009653, GO:0007275, GO:0044699, GO:0048869, GO:0008150, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0046530, GO:0001654
GO:0021536 [BP]	diencephalon development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0048731, GO:0008150, GO:0007275, GO:0044699, GO:0007417
GO:0048704 [BP]	embryonic skeletal system morphogenesis	probable	GO:0048705, GO:0048598, GO:0009887, GO:0048562, GO:0044707, GO:0048513, GO:0009790, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0001501, GO:0048706, GO:0008150, GO:0009792, GO:0048731, GO:0043009, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0007411 [BP]	axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0000977 [MF]	RNA polymerase II regulatory region sequence-specific DNA binding	probable	GO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0060284 [BP]	regulation of cell development	probable	GO:0050793, GO:0050794, GO:0045595, GO:0008150, GO:0065007, GO:0050789
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0071837 [MF]	HMG box domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:2000026 [BP]	regulation of multicellular organismal development	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0009952 [BP]	anterior/posterior pattern specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0001942 [BP]	hair follicle development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0022405, GO:0009888, GO:0022404, GO:0048513, GO:0008150, GO:0042633, GO:0048731, GO:0008544, GO:0042303, GO:0007275, GO:0044699
GO:0030326 [BP]	embryonic limb morphogenesis	probable	GO:0048598, GO:0032502, GO:0035108, GO:0044707, GO:0060173, GO:0035107, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0044699, GO:0035113, GO:0009653, GO:0007275, GO:0048736, GO:0048856
GO:0003705 [MF]	RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0030426 [CC]	growth cone	probable	GO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0001077 [MF]	RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription	probable	GO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0042981 [BP]	regulation of apoptotic process	probable	GO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0060041 [BP]	retina development in camera-type eye	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030901 [BP]	midbrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0030902 [BP]	hindbrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0007517 [BP]	muscle organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0051216 [BP]	cartilage development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000983 [MF]	RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0006461 [BP]	protein complex assembly	probable	GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0021904 [BP]	dorsal/ventral neural tube patterning	probable	GO:0032502, GO:0007389, GO:0032501, GO:0021915, GO:0021532, GO:0007399, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0048731, GO:0009953, GO:0043009, GO:0044707, GO:0044699
GO:0048663 [BP]	neuron fate commitment	probable	GO:0032502, GO:0048699, GO:0045165, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0032501, GO:0044763, GO:0048731, GO:0044707, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0042472 [BP]	inner ear morphogenesis	probable	GO:0042471, GO:0048598, GO:0048839, GO:0048562, GO:0044707, GO:0007423, GO:0048568, GO:0032501, GO:0048856, GO:0009887, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0009653, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJL, chain A
Confidence level:very confident
Coverage over the Query: 94-141
View the alignment between query and template
View the model in PyMOL