Psyllid ID: psy18046

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MGFNDQLGNLSGRFNLVLHLHSDSHHADSNKLDPISHNLNHLDNTDPNDLEISNDLEINDDSASNASSYDYGNHGNKMADLGERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHc
mgfndqlgnlsGRFNLVLHLhsdshhadsnkldpishnlnhldntdpndleisndleinddsasnassydygnhgnkmadlgergggsankprkirrsrttfTTYQLHQLERafdktqypdvftreDLASRLDLSEARVQF
MGFNDQLGNLSGRFNLVLHLHSDSHHADSNKLDPISHNLNHLDNTDPNDLEISNDLEINDDSASNASSYDYGNHGNKMadlgergggsankprkirrsrtTFTTYQLHqlerafdktqypdVFTREdlasrldlsearvqf
MGFNDQLGNLSGRFNLVlhlhsdshhadsNKLDPISHNLNHLDNTDPNDLEISNDLEInddsasnassydyGNHGNKMADLGERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF
************RFNLVLHL********************************************************************************TFTTYQLHQLERAFDKTQYPDVFT*****************
******L*********************************************************************************************TFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF
MGFNDQLGNLSGRFNLVLHLHSDSHHADSNKLDPISHNLNHLDNTDPNDLEISNDLEINDDSASNASSYDYGNHGNKMADLGER*********KIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF
**************************************************************************************************RTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEAR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFNDQLGNLSGRFNLVLHLHSDSHHADSNKLDPISHNLNHLDNTDPNDLEISNDLEINDDSASNASSYDYGNHGNKMADLGERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q26657327 Aristaless homeobox prote no N/A 0.432 0.186 0.650 3e-16
Q96QS3 562 Homeobox protein ARX OS=H yes N/A 0.340 0.085 0.791 5e-16
O42115 453 Aristaless-related homeob no N/A 0.347 0.108 0.775 6e-16
A6YP92 566 Homeobox protein ARX OS=R yes N/A 0.340 0.084 0.791 7e-16
O35085 564 Homeobox protein ARX OS=M yes N/A 0.340 0.085 0.791 8e-16
Q9I9A2 327 Retinal homeobox protein N/A N/A 0.347 0.149 0.653 1e-14
Q9W2Q1 873 Retinal homeobox protein no N/A 0.347 0.056 0.653 2e-14
Q9JLT7 342 Retinal homeobox protein no N/A 0.347 0.143 0.653 2e-14
O35602 342 Retinal homeobox protein no N/A 0.340 0.140 0.666 2e-14
Q9PVX0 317 Retinal homeobox protein yes N/A 0.340 0.151 0.666 3e-14
>sp|Q26657|ALX_STRPU Aristaless homeobox protein (Fragment) OS=Strongylocentrotus purpuratus GN=ALX PE=2 SV=2 Back     alignment and function desciption
 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 49/63 (77%), Gaps = 2/63 (3%)

Query: 81  LGERGGGSANKP--RKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEAR 138
           L E G  + ++P  RK RR RTTFT+YQL +LERAF KT YPDVFTRE+LA R+DL+EAR
Sbjct: 196 LDEHGSNAGDRPTKRKQRRYRTTFTSYQLEELERAFCKTHYPDVFTREELAMRVDLTEAR 255

Query: 139 VQF 141
           VQ 
Sbjct: 256 VQV 258

Strongylocentrotus purpuratus (taxid: 7668)
>sp|Q96QS3|ARX_HUMAN Homeobox protein ARX OS=Homo sapiens GN=ARX PE=1 SV=1 Back     alignment and function description
>sp|O42115|ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio GN=arx PE=2 SV=1 Back     alignment and function description
>sp|A6YP92|ARX_RAT Homeobox protein ARX OS=Rattus norvegicus GN=Arx PE=2 SV=1 Back     alignment and function description
>sp|O35085|ARX_MOUSE Homeobox protein ARX OS=Mus musculus GN=Arx PE=2 SV=3 Back     alignment and function description
>sp|Q9I9A2|RX2_ORYLA Retinal homeobox protein Rx2 OS=Oryzias latipes GN=rx2 PE=2 SV=1 Back     alignment and function description
>sp|Q9W2Q1|RX_DROME Retinal homeobox protein Rx OS=Drosophila melanogaster GN=Rx PE=2 SV=2 Back     alignment and function description
>sp|Q9JLT7|RX_RAT Retinal homeobox protein Rx OS=Rattus norvegicus GN=Rax PE=2 SV=1 Back     alignment and function description
>sp|O35602|RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus GN=Rax PE=2 SV=2 Back     alignment and function description
>sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 OS=Gallus gallus GN=RX2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
295389208 294 homeobrain [Nematostella vectensis] 0.425 0.204 0.816 3e-21
156386935214 predicted protein [Nematostella vectensi 0.418 0.275 0.830 5e-21
405961985 442 Homeobox protein ARX [Crassostrea gigas] 0.496 0.158 0.722 2e-20
291222403 379 PREDICTED: predicted protein-like [Sacco 0.375 0.139 0.867 3e-20
270010993 261 homeobrain [Tribolium castaneum] 0.361 0.195 0.901 5e-20
195401625 405 GJ18584 [Drosophila virilis] gi|19414241 0.390 0.135 0.836 6e-20
195029473 395 GH19875 [Drosophila grimshawi] gi|193903 0.390 0.139 0.836 6e-20
339249747 560 retinal homeobox protein Rax [Trichinell 0.453 0.114 0.75 6e-20
195119468 411 GI19825 [Drosophila mojavensis] gi|19390 0.390 0.133 0.836 6e-20
312372108241 hypothetical protein AND_20593 [Anophele 0.361 0.211 0.901 8e-20
>gi|295389208|gb|ADG03434.1| homeobrain [Nematostella vectensis] Back     alignment and taxonomy information
 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/60 (81%), Positives = 52/60 (86%)

Query: 82  GERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF 141
           GE   G   KPRK+RRSRTTFTTYQLHQLERAF+KTQYPDVFTRE+LA RLDLSEARVQ 
Sbjct: 87  GEESAGEDGKPRKVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQV 146

Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota
>gi|156386935|ref|XP_001634166.1| predicted protein [Nematostella vectensis] gi|156221246|gb|EDO42103.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|405961985|gb|EKC27709.1| Homeobox protein ARX [Crassostrea gigas] Back     alignment and taxonomy information
>gi|291222403|ref|XP_002731203.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|270010993|gb|EFA07441.1| homeobrain [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195401625|ref|XP_002059413.1| GJ18584 [Drosophila virilis] gi|194142419|gb|EDW58825.1| GJ18584 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195029473|ref|XP_001987597.1| GH19875 [Drosophila grimshawi] gi|193903597|gb|EDW02464.1| GH19875 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|339249747|ref|XP_003373861.1| retinal homeobox protein Rax [Trichinella spiralis] gi|316969949|gb|EFV53972.1| retinal homeobox protein Rax [Trichinella spiralis] Back     alignment and taxonomy information
>gi|195119468|ref|XP_002004253.1| GI19825 [Drosophila mojavensis] gi|193909321|gb|EDW08188.1| GI19825 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|312372108|gb|EFR20142.1| hypothetical protein AND_20593 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
FB|FBgn0008636 409 hbn "homeobrain" [Drosophila m 0.425 0.146 0.735 8.9e-20
UNIPROTKB|E2R5X4 184 RAX2 "Uncharacterized protein" 0.439 0.336 0.580 8.8e-15
UNIPROTKB|G1K2Z3 245 PRRX1 "Paired mesoderm homeobo 0.354 0.204 0.64 2.4e-14
UNIPROTKB|G1K361214 PRRX1 "Paired mesoderm homeobo 0.354 0.233 0.64 2.4e-14
UNIPROTKB|Q05437 245 PRRX1 "Paired mesoderm homeobo 0.354 0.204 0.64 2.4e-14
UNIPROTKB|I3LRI8 451 I3LRI8 "Uncharacterized protei 0.340 0.106 0.791 2.4e-14
ZFIN|ZDB-GENE-990415-15 453 arxa "aristaless related homeo 0.340 0.105 0.791 2.5e-14
UNIPROTKB|Q7YRX0 184 RAX2 "Retina and anterior neur 0.439 0.336 0.580 3e-14
UNIPROTKB|F1S7P4 184 RAX2 "Uncharacterized protein" 0.439 0.336 0.580 3e-14
UNIPROTKB|J9NW39 520 ARX "Uncharacterized protein" 0.340 0.092 0.791 3.3e-14
FB|FBgn0008636 hbn "homeobrain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 239 (89.2 bits), Expect = 8.9e-20, P = 8.9e-20
 Identities = 50/68 (73%), Positives = 58/68 (85%)

Query:    73 NHGNKMADLGERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRL 132
             N+G+ ++D+ ER       PRK+RRSRTTFTT+QLHQLERAF+KTQYPDVFTREDLA RL
Sbjct:   139 NNGHDLSDM-ER-------PRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRL 190

Query:   133 DLSEARVQ 140
             DLSEARVQ
Sbjct:   191 DLSEARVQ 198
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0005634 "nucleus" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
UNIPROTKB|E2R5X4 RAX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G1K2Z3 PRRX1 "Paired mesoderm homeobox protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K361 PRRX1 "Paired mesoderm homeobox protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q05437 PRRX1 "Paired mesoderm homeobox protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRI8 I3LRI8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-15 arxa "aristaless related homeobox a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q7YRX0 RAX2 "Retina and anterior neural fold homeobox protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7P4 RAX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW39 ARX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
pfam0004657 pfam00046, Homeobox, Homeobox domain 6e-19
smart0038957 smart00389, HOX, Homeodomain 4e-15
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 4e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 8e-05
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 74.4 bits (184), Expect = 6e-19
 Identities = 23/45 (51%), Positives = 32/45 (71%)

Query: 96  RRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQ 140
           RR RTTFT  QL +LE+ F+K +YP    RE+LA +L L+E +V+
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVK 45

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG0842|consensus 307 99.51
KOG0489|consensus261 99.51
KOG0488|consensus309 99.48
KOG0850|consensus245 99.42
KOG0484|consensus125 99.36
KOG0487|consensus308 99.36
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.31
KOG2251|consensus 228 99.29
KOG0843|consensus197 99.26
KOG0485|consensus 268 99.25
KOG0486|consensus 351 99.22
KOG0848|consensus317 99.21
KOG0492|consensus246 99.17
KOG0494|consensus 332 99.15
KOG0493|consensus342 99.14
KOG0844|consensus 408 99.06
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.87
KOG0491|consensus194 98.74
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.69
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.56
KOG0490|consensus 235 98.51
KOG0849|consensus 354 98.48
COG5576156 Homeodomain-containing transcription factor [Trans 97.9
KOG0847|consensus288 97.87
KOG0483|consensus 198 97.74
KOG4577|consensus 383 97.72
KOG3802|consensus398 97.67
KOG2252|consensus558 97.03
KOG0490|consensus235 95.92
KOG1168|consensus385 94.7
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 93.89
KOG0774|consensus334 93.37
KOG0775|consensus304 93.0
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 85.76
KOG1146|consensus 1406 81.35
>KOG0842|consensus Back     alignment and domain information 
Probab=99.51  E-value=8.9e-14  Score=111.73  Aligned_cols=52  Identities=37%  Similarity=0.532  Sum_probs=49.1

Q ss_pred             CCCCCCCCCCCccCHHHHHHHHHhhhcCCCCCHHHHHHHHHHcCCCCCcccC
Q psy18046         90 NKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF  141 (141)
Q Consensus        90 ~~~~k~rr~Rt~ft~~Ql~~Le~~F~~~~y~~~~~r~~LA~~l~L~e~qVKV  141 (141)
                      ...+++||.|..||..|..|||++|..++|++.++|++||..|+||++||||
T Consensus       148 t~~~~kRKrRVLFSqAQV~ELERRFrqQRYLSAPERE~LA~~LrLT~TQVKI  199 (307)
T KOG0842|consen  148 TGKRKKRKRRVLFSQAQVYELERRFRQQRYLSAPEREHLASSLRLTPTQVKI  199 (307)
T ss_pred             cccccccccccccchhHHHHHHHHHHhhhccccHhHHHHHHhcCCCchheee
Confidence            3466788899999999999999999999999999999999999999999998

>KOG0489|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-13
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-13
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 3e-13
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 7e-13
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 6e-12
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 7e-11
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 5e-10
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 4e-09
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 8e-07
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 9e-07
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 2e-06
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 9e-05
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 2e-04
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 7e-04
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/48 (66%), Positives = 42/48 (87%)
Query: 93  RKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQ 140
           RK RRSRTTF+  QL +LERAF++TQYPD++TRE+LA R +L+EAR+Q
Sbjct: 16  RKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 63
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-29
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-29
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-29
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 7e-28
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-27
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-27
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-26
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 3e-26
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-25
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-24
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-23
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-20
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-19
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-19
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-17
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 6e-15
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 7e-14
1lfb_A99 Liver transcription factor (LFB1); transcription r 1e-13
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-13
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-13
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 6e-13
2xsd_C164 POU domain, class 3, transcription factor 1; trans 8e-13
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-12
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-12
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-12
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-12
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 4e-12
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 4e-12
3a01_A93 Homeodomain-containing protein; homeodomain, prote 6e-12
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 8e-12
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 3e-11
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 8e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-10
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-10
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-10
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 5e-09
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-08
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-08
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-08
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 7e-08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-07
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-06
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-06
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 6e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 7e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 7e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 7e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  101 bits (253), Expect = 2e-29
 Identities = 32/59 (54%), Positives = 42/59 (71%)

Query: 82  GERGGGSANKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQ 140
                      RK RRSRTTF+  QL +LERAF++TQYPD++TRE+LA R +L+EAR+Q
Sbjct: 5   DCESEPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 63
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.48
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.47
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.46
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.42
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.41
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.39
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.38
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.38
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.37
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.36
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.35
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.35
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.34
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.34
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.34
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.34
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.34
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.33
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.32
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.31
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.31
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.31
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.31
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.31
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.31
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.3
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.3
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.29
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.28
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.28
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.28
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.27
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.27
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.27
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.27
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.26
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.22
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.22
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.22
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.2
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.19
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.18
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.17
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.15
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.15
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.14
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.14
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.14
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.12
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.11
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.1
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.09
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.09
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.08
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.08
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.04
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.04
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.04
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.02
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.0
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 98.97
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 98.93
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 98.93
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.91
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 98.88
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.87
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.86
2e19_A64 Transcription factor 8; homeobox domain, structura 98.85
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 98.83
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.71
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.49
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.31
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.07
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 97.86
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 89.17
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.48  E-value=4e-14  Score=92.61  Aligned_cols=50  Identities=16%  Similarity=0.144  Sum_probs=47.3

Q ss_pred             CCCCCCCCCccCHHHHHHHHHhhhc----CCCCCHHHHHHHHHHcCCCCCcccC
Q psy18046         92 PRKIRRSRTTFTTYQLHQLERAFDK----TQYPDVFTREDLASRLDLSEARVQF  141 (141)
Q Consensus        92 ~~k~rr~Rt~ft~~Ql~~Le~~F~~----~~y~~~~~r~~LA~~l~L~e~qVKV  141 (141)
                      .+++||.||.||.+|+.+||..|+.    ++||+..+|++||..|+|++.||||
T Consensus        14 ~~~~rR~Rt~ft~~Ql~~Le~~f~~~~~~~~yp~~~~r~~La~~lgL~~~~Vkv   67 (80)
T 1wh5_A           14 GGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKV   67 (80)
T ss_dssp             CCCSCCCSCCCCHHHHHHHHHHHHHHTSCCCTTTHHHHHHHHHHSCCCHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHHHHHhccCcCCCcCHHHHHHHHHHhCCCcccccC
Confidence            4567889999999999999999999    9999999999999999999999986
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-16
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-16
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 8e-16
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-15
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 5e-15
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 9e-15
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 4e-14
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 4e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-14
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 6e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 6e-14
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 8e-14
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 9e-14
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 9e-14
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-13
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-13
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 8e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 4e-12
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-11
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 5e-10
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 8e-10
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 9e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-09
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 7e-09
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 7e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 9e-05
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.5 bits (165), Expect = 1e-16
 Identities = 25/45 (55%), Positives = 36/45 (80%)

Query: 96  RRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQ 140
           +R+RT+FT  Q+  LE+ F++T YPDVF RE LA+++DL EAR+Q
Sbjct: 2   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQ 46
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.44
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.43
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.42
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.42
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.4
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.39
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.38
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.37
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.37
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.36
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.35
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.35
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.33
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.32
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.28
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.26
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.25
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.24
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.2
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.16
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.12
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.11
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.11
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 98.98
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.89
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.82
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.78
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.74
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.59
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.57
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.43
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.4
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: VND/NK-2 protein
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.44  E-value=2.1e-14  Score=91.80  Aligned_cols=52  Identities=37%  Similarity=0.516  Sum_probs=48.3

Q ss_pred             CCCCCCCCCCCccCHHHHHHHHHhhhcCCCCCHHHHHHHHHHcCCCCCcccC
Q psy18046         90 NKPRKIRRSRTTFTTYQLHQLERAFDKTQYPDVFTREDLASRLDLSEARVQF  141 (141)
Q Consensus        90 ~~~~k~rr~Rt~ft~~Ql~~Le~~F~~~~y~~~~~r~~LA~~l~L~e~qVKV  141 (141)
                      +.+.++||.||.||.+|+..||..|+.++||+..+|++||..|||++.||+|
T Consensus         4 g~p~k~rr~Rt~ft~~Q~~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~qV~~   55 (77)
T d1vnda_           4 GLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKI   55 (77)
T ss_dssp             CCSSSSCSSCCCCCTTHHHHHHHHHHHCSCCCHHHHHHHHHHHTCCHHHHHH
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChhhhhh
Confidence            4456678899999999999999999999999999999999999999999986
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure