Diaphorina citri psyllid: psy18052


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGKFSAGSTFIWLCALILGYHQSHEAKSPYEESLTSFICKVCTWFCISRVQDMITCSYIEWF
ccccccCEEEEEEEECcccccccEEEEEEcccccccccCCccEEEEEcccccccEECccccCCcccccccccEEEEEEccEEEEEEEEcEEEEEEEEc
*****SKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGKFSAGSTFIWLCALILGYHQ***********LTSFICKVCTWFCISRVQDMITCSYIEWF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAQGSKTGVLRFKGTTQFAQGEWCGVELDEPIGKNDGKFSAGSTFIWLCALILGYHQSHEAKSPYEESLTSFICKVCTWFCISRVQDMITCSYIEWF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CAP-Gly domain-containing linker protein 2 Seems to link microtubules to dendritic lamellar body (DLB), a membranous organelle predominantly present in bulbous dendritic appendages of neurons linked by dendrodendritic gap junctions. May operates in the control of brain-specific organelle translocations.confidentQ9UDT6
CAP-Gly domain-containing linker protein 2 Seems to link microtubules to dendritic lamellar body (DLB), a membranous organelle predominantly present in bulbous dendritic appendages of neurons linked by dendrodendritic gap junctions. May operates in the control of brain-specific organelle translocations.confidentQ9Z0H8
CAP-Gly domain-containing linker protein 2 Seems to link microtubules to dendritic lamellar body (DLB), a membranous organelle predominantly present in bulbous dendritic appendages of neurons linked by dendrodendritic gap junctions. May operates in the control of brain-specific organelle translocations.confidentO55156

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044354 [CC]macropinosomeprobableGO:0005737, GO:0043231, GO:0044352, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0071889 [MF]14-3-3 protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051010 [MF]microtubule plus-end bindingprobableGO:0015631, GO:0008092, GO:0008017, GO:0003674, GO:0005488, GO:0005515
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0090004 [BP]positive regulation of establishment of protein localization to plasma membraneprobableGO:0051130, GO:0070201, GO:0032879, GO:0060341, GO:0051128, GO:0032880, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0090003, GO:0050789, GO:0048522
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0035594 [MF]ganglioside bindingprobableGO:0043208, GO:0046625, GO:0008289, GO:0097001, GO:0003674, GO:0005488, GO:0051861
GO:0035371 [CC]microtubule plus endprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0031901 [CC]early endosome membraneprobableGO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0001578 [BP]microtubule bundle formationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0050770 [BP]regulation of axonogenesisprobableGO:0022604, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0031116 [BP]positive regulation of microtubule polymerizationprobableGO:0031110, GO:0031112, GO:0031113, GO:0033043, GO:0051128, GO:0032886, GO:0050789, GO:0051495, GO:0051493, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0051130, GO:0031334, GO:0050794, GO:0008150, GO:0043254, GO:0010638, GO:0044087, GO:0070507, GO:0048522
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0055038 [CC]recycling endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0055037, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CP0, chain A
Confidence level:very confident
Coverage over the Query: 4-70
View the alignment between query and template
View the model in PyMOL