Diaphorina citri psyllid: psy18055

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND
ccEEEEEcccccccHHHHHHHcccEEEEEEEcccccEEEEEEccccccccccCECccccccccccEEEEEEcccHHHHHHHHHHcccEEEccccc
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lactoylglutathione lyase Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.confidentP0A1Q2
Lactoylglutathione lyase Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.confidentP44638
Probable lactoylglutathione lyase Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.confidentQ9KT93

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006749 [BP]glutathione metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0004462 [MF]lactoylglutathione lyase activityprobableGO:0003824, GO:0016829, GO:0016846, GO:0003674
GO:0005975 [BP]carbohydrate metabolic processprobableGO:0044238, GO:0008150, GO:0008152, GO:0071704
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0016151 [MF]nickel cation bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0019243 [BP]methylglyoxal catabolic process to D-lactateprobableGO:1901575, GO:0046185, GO:0006081, GO:0006082, GO:0009056, GO:0009987, GO:0006089, GO:0019752, GO:0032787, GO:0044248, GO:0071704, GO:0044710, GO:0051596, GO:0044237, GO:0008152, GO:0043436, GO:0008150, GO:0009438, GO:0044281, GO:1901615

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.4.-.-Carbon-sulfur lyases.probable
4.4.1.-Carbon-sulfur lyases.probable
4.4.1.5Lactoylglutathione lyase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZA0, chain A
Confidence level:very confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL