Psyllid ID: psy18055


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND
ccEEEEEcccccccHHHHHHHcccEEEEEEEcccccEEEEEEccccccccccEEEccccccccccEEEEEEcccHHHHHHHHHHcccEEEccccc
EEEEEEEcccHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEccHHHcccccccccccccccEEEEEEEcccHHHHHHHHHHcccEEEEcccc
mqqtmyrikdprkslpfYTKVLGMSLlkkldfpaMKFSLYfmgnwgtekdedltyhngnsdprgfghigiqvpdVTKACERFEQLGVEFVKKPND
mqqtmyrikdprkslpfYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLgvefvkkpnd
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND
*************SLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFV*****
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKK***
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKK***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query95 2.2.26 [Sep-21-2011]
Q9CPU0184 Lactoylglutathione lyase yes N/A 1.0 0.516 0.596 3e-36
Q6P7Q4184 Lactoylglutathione lyase yes N/A 1.0 0.516 0.588 6e-36
Q4R5F2184 Lactoylglutathione lyase N/A N/A 1.0 0.516 0.580 1e-35
Q42891185 Lactoylglutathione lyase N/A N/A 1.0 0.513 0.608 5e-35
Q04760184 Lactoylglutathione lyase yes N/A 1.0 0.516 0.572 6e-35
O49818186 Lactoylglutathione lyase N/A N/A 1.0 0.510 0.6 1e-34
O04885185 Lactoylglutathione lyase N/A N/A 1.0 0.513 0.584 2e-34
Q8H0V3185 Lactoylglutathione lyase yes N/A 1.0 0.513 0.584 2e-34
Q9ZS21185 Lactoylglutathione lyase no N/A 1.0 0.513 0.584 9e-34
Q9HU72176 Lactoylglutathione lyase yes N/A 0.926 0.5 0.491 2e-25
>sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 Back     alignment and function desciption
 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/124 (59%), Positives = 86/124 (69%), Gaps = 29/124 (23%)

Query: 1   MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
           +QQTM RIKDP+KSL FYT+VLG++LL+KLDFPAMKFSLYF+                  
Sbjct: 32  LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAW 91

Query: 44  ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91
                       NWGTE DE  +YHNGNSDPRGFGHIGI VPDV  AC+RFE+LGV+FVK
Sbjct: 92  TFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVK 151

Query: 92  KPND 95
           KP+D
Sbjct: 152 KPDD 155




Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B.
Mus musculus (taxid: 10090)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 5
>sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 Back     alignment and function description
>sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 Back     alignment and function description
>sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 Back     alignment and function description
>sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 Back     alignment and function description
>sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 Back     alignment and function description
>sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 Back     alignment and function description
>sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 Back     alignment and function description
>sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
307182233 705 Tubulin-specific chaperone E [Camponotus 1.0 0.134 0.653 6e-39
380014619 711 PREDICTED: tubulin-specific chaperone E- 1.0 0.133 0.645 3e-38
328786212 711 PREDICTED: tubulin-specific chaperone E- 1.0 0.133 0.645 3e-38
350400723 746 PREDICTED: tubulin-specific chaperone E- 1.0 0.127 0.645 1e-37
307210247183 Lactoylglutathione lyase [Harpegnathos s 1.0 0.519 0.637 4e-37
157133353 501 lactoylglutathione lyase [Aedes aegypti] 0.989 0.187 0.593 5e-36
405963909179 Lactoylglutathione lyase [Crassostrea gi 0.989 0.525 0.626 9e-36
332374732158 unknown [Dendroctonus ponderosae] 1.0 0.601 0.596 9e-35
327262276183 PREDICTED: lactoylglutathione lyase-like 1.0 0.519 0.588 1e-34
165932331184 lactoylglutathione lyase [Mus musculus] 1.0 0.516 0.596 1e-34
>gi|307182233|gb|EFN69564.1| Tubulin-specific chaperone E [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 87/124 (70%), Gaps = 29/124 (23%)

Query: 1   MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
           MQQTMYRIKDPRKSLPFYT+VLGM+LL+KLDFP MKFSLYF+G                 
Sbjct: 28  MQQTMYRIKDPRKSLPFYTEVLGMTLLQKLDFPEMKFSLYFLGYENQKDIPTDKRESIEW 87

Query: 44  ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91
                       NWGTE D D  YHNGNSDPRGFGHIGI VPDV KACERFE+L VEF+K
Sbjct: 88  TFSRKATIELTHNWGTETDPDAKYHNGNSDPRGFGHIGIAVPDVEKACERFEKLNVEFIK 147

Query: 92  KPND 95
           KPND
Sbjct: 148 KPND 151




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380014619|ref|XP_003691323.1| PREDICTED: tubulin-specific chaperone E-like [Apis florea] Back     alignment and taxonomy information
>gi|328786212|ref|XP_001120710.2| PREDICTED: tubulin-specific chaperone E-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350400723|ref|XP_003485937.1| PREDICTED: tubulin-specific chaperone E-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307210247|gb|EFN86897.1| Lactoylglutathione lyase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157133353|ref|XP_001656216.1| lactoylglutathione lyase [Aedes aegypti] gi|108881553|gb|EAT45778.1| AAEL002957-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|405963909|gb|EKC29441.1| Lactoylglutathione lyase [Crassostrea gigas] Back     alignment and taxonomy information
>gi|332374732|gb|AEE62507.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|327262276|ref|XP_003215951.1| PREDICTED: lactoylglutathione lyase-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|165932331|ref|NP_079650.3| lactoylglutathione lyase [Mus musculus] gi|165932333|ref|NP_001107032.1| lactoylglutathione lyase [Mus musculus] gi|21362640|sp|Q9CPU0.3|LGUL_MOUSE RecName: Full=Lactoylglutathione lyase; AltName: Full=Aldoketomutase; AltName: Full=Glyoxalase I; Short=Glx I; AltName: Full=Ketone-aldehyde mutase; AltName: Full=Methylglyoxalase; AltName: Full=S-D-lactoylglutathione methylglyoxal lyase gi|196049696|pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin gi|196049697|pdb|2ZA0|B Chain B, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin gi|12832330|dbj|BAB22060.1| unnamed protein product [Mus musculus] gi|12834312|dbj|BAB22863.1| unnamed protein product [Mus musculus] gi|12836716|dbj|BAB23781.1| unnamed protein product [Mus musculus] gi|26327653|dbj|BAC27570.1| unnamed protein product [Mus musculus] gi|26340438|dbj|BAC33882.1| unnamed protein product [Mus musculus] gi|51859026|gb|AAH81432.1| Glyoxalase 1 [Mus musculus] gi|94962335|gb|ABF48483.1| glyoxalase I [Mus musculus] gi|94962337|gb|ABF48484.1| glyoxalase I [Mus musculus] gi|148676704|gb|EDL08651.1| glyoxalase 1 [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
UNIPROTKB|F1N9Q2190 GLO1 "Uncharacterized protein" 0.631 0.315 0.733 7.3e-38
MGI|MGI:95742184 Glo1 "glyoxalase 1" [Mus muscu 0.631 0.326 0.716 2.4e-37
FB|FBgn0033162176 CG1707 [Drosophila melanogaste 0.631 0.340 0.65 3.1e-37
RGD|2702184 Glo1 "glyoxalase 1" [Rattus no 0.631 0.326 0.716 4e-37
UNIPROTKB|Q4R5F2184 GLO1 "Lactoylglutathione lyase 0.631 0.326 0.716 8.2e-37
UNIPROTKB|J9NRV6184 GLO1 "Uncharacterized protein" 0.631 0.326 0.7 1.3e-36
UNIPROTKB|I3LDM7184 GLO1 "Uncharacterized protein" 0.631 0.326 0.7 2.7e-36
UNIPROTKB|A4FUZ1184 GLO1 "GLO1 protein" [Bos tauru 0.631 0.326 0.683 2.7e-36
UNIPROTKB|Q5EI50149 Q5EI50 "GekBS101P" [Gekko japo 0.631 0.402 0.733 3.5e-36
TAIR|locus:2205110235 AT1G08110 [Arabidopsis thalian 0.547 0.221 0.754 1.2e-35
UNIPROTKB|F1N9Q2 GLO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 7.3e-38, Sum P(2) = 7.3e-38
 Identities = 44/60 (73%), Positives = 50/60 (83%)

Query:    36 KFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND 95
             K +L    NWGTE DE  +YHNGNSDPRGFGHIGI VPDV KAC+RFE+LGV+FVKKP+D
Sbjct:   102 KATLELTHNWGTENDEKQSYHNGNSDPRGFGHIGIAVPDVNKACKRFEELGVKFVKKPDD 161


GO:0046872 "metal ion binding" evidence=IEA
GO:0004462 "lactoylglutathione lyase activity" evidence=IEA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0043066 "negative regulation of apoptotic process" evidence=IEA
MGI|MGI:95742 Glo1 "glyoxalase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0033162 CG1707 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2702 Glo1 "glyoxalase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R5F2 GLO1 "Lactoylglutathione lyase" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRV6 GLO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDM7 GLO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUZ1 GLO1 "GLO1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EI50 Q5EI50 "GekBS101P" [Gekko japonicus (taxid:146911)] Back     alignment and assigned GO terms
TAIR|locus:2205110 AT1G08110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P44638LGUL_HAEIN4, ., 4, ., 1, ., 50.31420.86310.6074yesN/A
P0A0T2LGUL_NEIMA4, ., 4, ., 1, ., 50.380.95780.6594yesN/A
Q04760LGUL_HUMAN4, ., 4, ., 1, ., 50.57251.00.5163yesN/A
Q9KT93LGUL_VIBCH4, ., 4, ., 1, ., 50.37110.94730.6521yesN/A
P0AC83LGUL_SHIFL4, ., 4, ., 1, ., 50.40210.89470.6296yesN/A
Q9CPU0LGUL_MOUSE4, ., 4, ., 1, ., 50.59671.00.5163yesN/A
Q8H0V3LGUL_ARATH4, ., 4, ., 1, ., 50.5841.00.5135yesN/A
P0A1Q2LGUL_SALTY4, ., 4, ., 1, ., 50.37370.96840.6814yesN/A
P0A0T3LGUL_NEIMB4, ., 4, ., 1, ., 50.380.95780.6594yesN/A
Q6P7Q4LGUL_RAT4, ., 4, ., 1, ., 50.58871.00.5163yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.4.1LOW CONFIDENCE prediction!
4th Layer4.4.1.50.914

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
PLN03042185 PLN03042, PLN03042, Lactoylglutathione lyase; Prov 2e-55
PLN02367233 PLN02367, PLN02367, lactoylglutathione lyase 2e-52
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 7e-43
TIGR00068150 TIGR00068, glyox_I, lactoylglutathione lyase 2e-41
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 3e-16
PRK10291129 PRK10291, PRK10291, glyoxalase I; Provisional 8e-15
PLN02300 286 PLN02300, PLN02300, lactoylglutathione lyase 2e-14
PLN02300286 PLN02300, PLN02300, lactoylglutathione lyase 9e-11
cd06587110 cd06587, Glo_EDI_BRP_like, This domain superfamily 1e-09
pfam12681109 pfam12681, Glyoxalase_2, Glyoxalase-like domain 5e-09
COG0346138 COG0346, GloA, Lactoylglutathione lyase and relate 2e-05
cd07245114 cd07245, Glo_EDI_BRP_like_9, This conserved domain 3e-05
cd08346126 cd08346, PcpA_N_like, N-terminal domain of Sphingo 8e-05
cd07237154 cd07237, BphC1-RGP6_C_like, C-terminal domain of 2 0.001
cd07249128 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) 0.002
>gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional Back     alignment and domain information
 Score =  169 bits (429), Expect = 2e-55
 Identities = 76/125 (60%), Positives = 85/125 (68%), Gaps = 30/125 (24%)

Query: 1   MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
           MQQTM+RIKDP+ SL FY++VLGMSLLK+LDFP MKFSLYF+G                 
Sbjct: 28  MQQTMFRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDSETAPTDPPERTVW 87

Query: 44  ------------NWGTEKDEDLT-YHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFV 90
                       NWGTE D +   YHNGNSDPRGFGHIGI V DV KACERFE+LGVEFV
Sbjct: 88  TFGRKATIELTHNWGTESDPEFKGYHNGNSDPRGFGHIGITVDDVYKACERFEKLGVEFV 147

Query: 91  KKPND 95
           KKP+D
Sbjct: 148 KKPDD 152


Length = 185

>gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional Back     alignment and domain information
>gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain Back     alignment and domain information
>gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>gnl|CDD|176661 cd07237, BphC1-RGP6_C_like, C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 95
PLN02367233 lactoylglutathione lyase 99.83
PLN03042185 Lactoylglutathione lyase; Provisional 99.8
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.76
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 99.74
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.71
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.71
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.7
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 99.7
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 99.7
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 99.7
PRK10291129 glyoxalase I; Provisional 99.68
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 99.68
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 99.68
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.68
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 99.68
PRK11478129 putative lyase; Provisional 99.67
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 99.67
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 99.65
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 99.65
PLN02300 286 lactoylglutathione lyase 99.65
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 99.65
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.64
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 99.63
KOG2944|consensus170 99.63
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.62
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 99.62
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.61
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 99.61
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 99.6
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 99.6
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 99.6
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 99.6
PRK06724128 hypothetical protein; Provisional 99.59
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 99.58
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 99.58
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 99.57
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.57
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 99.56
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 99.55
PRK04101139 fosfomycin resistance protein FosB; Provisional 99.55
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 99.55
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 99.55
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 99.54
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 99.54
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.53
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 99.53
COG3324127 Predicted enzyme related to lactoylglutathione lya 99.53
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 99.53
PLN02300286 lactoylglutathione lyase 99.53
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 99.52
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 99.52
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 99.52
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 99.52
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.52
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.52
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 99.5
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 99.5
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 99.5
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 99.49
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.49
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 99.48
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.46
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.46
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.45
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 99.44
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.44
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 99.44
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 99.44
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 99.44
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.43
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 99.42
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.41
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 99.4
TIGR01263 353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.4
TIGR03211 303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.38
TIGR02295 294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.38
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 99.36
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 99.36
TIGR03213 286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.34
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.33
PLN02875 398 4-hydroxyphenylpyruvate dioxygenase 99.28
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.25
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 99.21
KOG0638|consensus 381 99.11
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 99.1
COG2764136 PhnB Uncharacterized protein conserved in bacteria 99.05
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 98.98
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 98.95
KOG2943|consensus 299 98.87
PLN02875 398 4-hydroxyphenylpyruvate dioxygenase 98.85
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 98.82
KOG2943|consensus299 98.78
COG2514 265 Predicted ring-cleavage extradiol dioxygenase [Gen 98.7
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 98.55
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 98.49
COG3607133 Predicted lactoylglutathione lyase [General functi 98.48
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 98.14
PRK10148147 hypothetical protein; Provisional 98.1
KOG0638|consensus381 98.09
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 98.08
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 97.77
PF06983116 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans 96.86
COG3185 363 4-hydroxyphenylpyruvate dioxygenase and related he 96.3
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 94.76
PF14507101 CppA_C: CppA C-terminal; PDB: 3E0R_D. 94.33
PF06185185 YecM: YecM protein; InterPro: IPR010393 This famil 94.08
PF15067236 FAM124: FAM124 family 93.69
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 93.51
PRK11700187 hypothetical protein; Provisional 93.41
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 92.34
cd08353 142 Glo_EDI_BRP_like_7 This conserved domain belongs t 91.81
cd07268149 Glo_EDI_BRP_like_4 This conserved domain belongs t 91.58
KOG2944|consensus170 90.89
TIGR03645 162 glyox_marine lactoylglutathione lyase family prote 90.69
PRK11478129 putative lyase; Provisional 89.01
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 88.92
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 88.08
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 87.53
PLN02367233 lactoylglutathione lyase 87.3
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 87.04
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 86.81
COG4747142 ACT domain-containing protein [General function pr 86.61
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 86.5
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 86.4
cd08347 157 PcpA_C_like C-terminal domain of Sphingobium chlor 85.93
KOG4657|consensus246 85.86
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 85.84
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 85.23
cd07237 154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 84.75
PF0220847 Sorb: Sorbin homologous domain; InterPro: IPR00312 83.02
cd07256 161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 82.41
PLN03042185 Lactoylglutathione lyase; Provisional 82.2
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
Probab=99.83  E-value=1.4e-19  Score=107.88  Aligned_cols=94  Identities=74%  Similarity=1.227  Sum_probs=72.3

Q ss_pred             CceeEEEECCchhcHHHhhhccCCEEeeeeeCCCCceEEEeecCCC-----------------Cccceee--ccc-----
Q psy18055          1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWG-----------------TEKDEDL--TYH-----   56 (95)
Q Consensus         1 l~hv~l~v~d~~~s~~FY~~~lg~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~--~~~-----   56 (95)
                      |+|++|+|+|+++|++||+++|||++..+...+++.+.+++++..+                 .....++  .+.     
T Consensus        76 ~~HtmlRVkDle~Sl~FYt~vLGm~ll~r~d~pe~~f~lyFL~~~~~~~~p~d~~~r~~~~~~~~~~LELt~n~g~e~~~  155 (233)
T PLN02367         76 MQQTMYRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPTDPTERTVWTFGQKATIELTHNWGTESDP  155 (233)
T ss_pred             EEEEEEEeCCHHHHHHHHHHhcCCEEeEEEecCCCcEEEEEeecCCccccccccccceeeccCCCCEEEEecCCCCCccc
Confidence            5899999999999999999999999999888888888888875211                 0111112  111     


Q ss_pred             ------CCCCCCCCcceEEEEeCCHHHHHHHHHHcCCeeecCCC
Q psy18055         57 ------NGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPN   94 (95)
Q Consensus        57 ------~~~~~~~g~~~i~f~v~d~~~~~~~l~~~G~~~~~~p~   94 (95)
                            .++..+.|.+|++|.|+|+++++++|+++|+++..+|.
T Consensus       156 ~~~~y~~gn~~p~G~~HIaf~VdDVdaa~erL~a~Gv~~v~~P~  199 (233)
T PLN02367        156 DFKGYHNGNSEPRGFGHIGITVDDVYKACERFEELGVEFVKKPN  199 (233)
T ss_pred             cchhcccCCCCCCCceEEEEEcCCHHHHHHHHHHCCCEEEeCCc
Confidence                  11222357789999999999999999999999998774



>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>KOG2944|consensus Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>KOG0638|consensus Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2943|consensus Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>KOG2943|consensus Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>KOG0638|consensus Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D Back     alignment and domain information
>PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function Back     alignment and domain information
>PF15067 FAM124: FAM124 family Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK11700 hypothetical protein; Provisional Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>KOG2944|consensus Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>KOG4657|consensus Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>PF02208 Sorb: Sorbin homologous domain; InterPro: IPR003127 Sorbin is an active peptide present in the digestive tract, where it has pro-absorptive and anti-secretory effects in different parts of the intestine, including the ability to decrease VIP (vasoactive intestinal peptide) and cholera toxin-induced secretion Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
2za0_A184 Crystal Structure Of Mouse Glyoxalase I Complexed W 3e-37
3vw9_A187 Human Glyoxalase I With An N-Hydroxypyridone Inhibi 5e-36
1fro_A183 Human Glyoxalase I With Benzyl-Glutathione Inhibito 6e-36
1bh5_A183 Human Glyoxalase I Q33e, E172q Double Mutant Length 1e-35
1f9z_A135 Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I 5e-12
2c21_A144 Specificity Of The Trypanothione-Dependednt Leishma 9e-09
>pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 Back     alignment and structure

Iteration: 1

Score = 150 bits (378), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 74/124 (59%), Positives = 86/124 (69%), Gaps = 29/124 (23%) Query: 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43 +QQTM RIKDP+KSL FYT+VLG++LL+KLDFPAMKFSLYF+ Sbjct: 32 LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAW 91 Query: 44 ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91 NWGTE DE +YHNGNSDPRGFGHIGI VPDV AC+RFE+LGV+FVK Sbjct: 92 TFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVK 151 Query: 92 KPND 95 KP+D Sbjct: 152 KPDD 155
>pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 Back     alignment and structure
>pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 Back     alignment and structure
>pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 Back     alignment and structure
>pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 Back     alignment and structure
>pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 3e-37
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 3e-35
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 1e-34
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 3e-23
2p25_A126 Glyoxalase family protein; structural genomics, MC 6e-18
3r6a_A144 Uncharacterized protein; PSI biology, structural g 2e-17
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 1e-16
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 1e-15
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 2e-12
3e5d_A127 Putative glyoxalase I; structural genomics, joint 3e-12
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 8e-12
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 4e-10
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 6e-10
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 1e-09
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 3e-09
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-08
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 5e-08
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 7e-08
1npb_A141 Fosfomycin-resistance protein; manganese binding, 1e-07
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-07
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 3e-07
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 3e-07
3ghj_A141 Putative integron gene cassette protein; integron 4e-07
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 1e-06
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 1e-06
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-06
3huh_A152 Virulence protein STM3117; structural genomics, ny 1e-06
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 1e-06
2i7r_A118 Conserved domain protein; structural genomics cons 1e-06
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 2e-06
1nki_A135 Probable fosfomycin resistance protein; potassium 2e-06
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 2e-06
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 3e-06
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 4e-06
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 4e-06
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 6e-06
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 7e-06
1ss4_A153 Glyoxalase family protein; structural genomics, PS 8e-06
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 9e-06
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 1e-05
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 1e-05
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 1e-05
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 1e-05
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 3e-05
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 3e-05
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 5e-05
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 8e-05
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 9e-05
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 1e-04
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 2e-04
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
 Score =  122 bits (308), Expect = 3e-37
 Identities = 74/124 (59%), Positives = 86/124 (69%), Gaps = 29/124 (23%)

Query: 1   MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
           +QQTM RIKDP+KSL FYT+VLG++LL+KLDFPAMKFSLYF+                  
Sbjct: 32  LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAW 91

Query: 44  ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91
                       NWGTE DE  +YHNGNSDPRGFGHIGI VPDV  AC+RFE+LGV+FVK
Sbjct: 92  TFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVK 151

Query: 92  KPND 95
           KP+D
Sbjct: 152 KPDD 155


>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.78
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.77
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.77
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.75
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.74
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.74
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.74
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.73
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 99.72
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.71
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 99.7
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.7
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.69
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.69
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 99.65
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 99.65
1ss4_A153 Glyoxalase family protein; structural genomics, PS 99.64
3ghj_A141 Putative integron gene cassette protein; integron 99.64
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 99.63
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 99.62
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 99.61
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 99.61
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 99.61
3huh_A152 Virulence protein STM3117; structural genomics, ny 99.61
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 99.61
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 99.6
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.6
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.59
2i7r_A118 Conserved domain protein; structural genomics cons 99.58
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 99.57
1nki_A135 Probable fosfomycin resistance protein; potassium 99.57
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.57
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 99.56
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 99.56
1npb_A141 Fosfomycin-resistance protein; manganese binding, 99.56
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 99.55
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 99.54
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 99.54
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 99.53
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.53
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.53
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 99.53
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.52
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.52
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 99.52
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.51
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 99.51
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.51
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.5
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.5
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 99.49
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.49
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.49
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 99.49
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.48
1t47_A 381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.48
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.48
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 99.48
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.47
3zi1_A 330 Glyoxalase domain-containing protein 4; isomerase; 99.46
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 99.46
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.46
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.45
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.44
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.44
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 99.44
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.44
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 99.44
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 99.43
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.43
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.43
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.42
3oxh_A 282 RV0577 protein; kinase regulation, antibiotic resi 99.42
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.42
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 99.42
1lgt_A 297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.42
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.42
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.41
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.41
3hpy_A 309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.41
4ghg_A 365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.41
1mpy_A 307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.41
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.41
1kw3_B 292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.4
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 99.4
1xy7_A166 Unknown protein; structural genomics, protein stru 99.4
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 99.38
2r5v_A 357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.38
1f1u_A 323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.36
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 99.34
2zyq_A 300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.33
2ehz_A 302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.32
2wl9_A 305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.3
3b59_A 310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.29
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.24
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.24
1cjx_A 357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.22
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.21
4ghg_A 365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.17
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 99.15
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 98.9
3l20_A172 Putative uncharacterized protein; hypothetical pro 98.9
1tsj_A139 Conserved hypothetical protein; structural genomic 98.83
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 98.19
3e0r_A 244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 98.16
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 97.12
3p8a_A 274 Uncharacterized protein; mainly antiparallel beta 97.1
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding 96.12
3e0r_A244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 95.02
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 92.06
1k4n_A192 Protein EC4020, protein YECM; structural genomics, 90.24
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 88.96
3gm5_A 159 Lactoylglutathione lyase and related lyases; sheet 88.3
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 87.79
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 85.82
3kol_A 156 Oxidoreductase, glyoxalase/bleomycin resistance pr 85.75
3uh9_A 145 Metallothiol transferase FOSB 2; structural genomi 85.46
3oa4_A 161 Glyoxalase, BH1468 protein; structural genomics, p 85.41
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 85.32
3huh_A152 Virulence protein STM3117; structural genomics, ny 84.86
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 83.79
3r4q_A 160 Lactoylglutathione lyase; structural genomics, PSI 83.1
3ghj_A141 Putative integron gene cassette protein; integron 82.93
1ss4_A 153 Glyoxalase family protein; structural genomics, PS 82.71
3iuz_A340 Putative glyoxalase superfamily protein; struct ge 80.74
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 80.41
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
Probab=99.78  E-value=1.7e-18  Score=94.20  Aligned_cols=93  Identities=17%  Similarity=0.293  Sum_probs=65.9

Q ss_pred             CceeEEEECCchhcHHHhhhccCCEEeeeeeCCCCceEEEeecCCCCccceeecccCCCC--------CCCCcceEEEEe
Q psy18055          1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNS--------DPRGFGHIGIQV   72 (95)
Q Consensus         1 l~hv~l~v~d~~~s~~FY~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~g~~~i~f~v   72 (95)
                      ++|++|.|+|++++++||+++|||++......+.......++...+..............        ...+..|++|.|
T Consensus         6 i~hv~l~v~D~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~g~~hi~~~v   85 (134)
T 3rmu_A            6 LNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEV   85 (134)
T ss_dssp             EEEEEEECSCHHHHHHHHHHTSCCEECCCEEEGGGTEEEEEEECSSSEEEEEEECSTTCTTHHHHHHCTTCEEEEEEEEE
T ss_pred             eeeEEEEeCCHHHHHHHHHHhcCCEEeEeeecCCCCEEEEEEecCCEEEEEEecCCCCchhhhhhhccCCCCceEEEEEc
Confidence            579999999999999999999999988765444444455555543332222111111111        123456999999


Q ss_pred             CCHHHHHHHHHHcCCeeecCC
Q psy18055         73 PDVTKACERFEQLGVEFVKKP   93 (95)
Q Consensus        73 ~d~~~~~~~l~~~G~~~~~~p   93 (95)
                      +|+++++++|+++|+++..+|
T Consensus        86 ~d~~~~~~~l~~~G~~~~~~~  106 (134)
T 3rmu_A           86 DNINAAVMDLKKKKIRSLSEE  106 (134)
T ss_dssp             SCHHHHHHHHHHTTCTTBCCC
T ss_pred             CCHHHHHHHHHHcCCcccCCC
Confidence            999999999999999987764



>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>3iuz_A Putative glyoxalase superfamily protein; struct genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: MLY P6G PGE; 1.90A {Ralstonia eutropha} Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 95
d1qipa_176 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 4e-16
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 2e-09
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 3e-09
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 2e-08
d1sqda1167 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg 1e-06
d1r9ca_130 d.32.1.2 (A:) Fosfomycin resistance protein FosX { 2e-06
d1mpya2162 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met 2e-05
d1t47a1163 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg 2e-05
d1sp8a1172 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg 2e-05
d1npba_140 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 3e-05
d1jc4a_145 d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion 4e-05
d1zswa2170 d.32.1.10 (A:145-314) Hypothetical protein BC1024 6e-05
d2pjsa1111 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 6e-05
d1nkia_134 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 3e-04
d1xrka_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 5e-04
d1zswa1144 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B 0.001
d1cjxa2203 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy 0.002
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Glyoxalase I (lactoylglutathione lyase)
domain: Glyoxalase I (lactoylglutathione lyase)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.3 bits (163), Expect = 4e-16
 Identities = 71/124 (57%), Positives = 84/124 (67%), Gaps = 29/124 (23%)

Query: 1   MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
           +QQTM R+KDP+KSL FYT+VLGM+L++K DFP MKFSLYF+                  
Sbjct: 24  LQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAW 83

Query: 44  ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91
                       NWGTE DE  +YHNGNSDPRGFGHIGI VPDV  AC+RFE+LGV+FVK
Sbjct: 84  ALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVK 143

Query: 92  KPND 95
           KP+D
Sbjct: 144 KPDD 147


>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.76
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.75
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.75
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 99.74
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.72
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 99.71
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 99.7
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.69
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.68
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 99.67
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 99.66
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.65
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 99.65
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.64
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.63
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.62
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.62
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.61
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.6
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 99.6
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.57
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.57
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 99.55
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 99.54
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.53
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.52
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.49
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 99.48
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.47
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.47
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.46
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.28
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.24
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.2
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.16
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.01
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 98.8
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 98.55
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 97.6
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 97.29
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 94.96
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 94.38
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 93.64
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 93.04
d1k4na_190 Hypothetical protein YecM (EC4020) {Escherichia co 92.7
d1zswa1 144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 91.75
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 91.29
d1kw3b2 156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 91.05
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 90.9
d1zswa2 170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 90.86
d1t47a1 163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 90.04
d1cjxa1 150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 89.91
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 89.79
d1sqia1 149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 88.81
d1npba_ 140 Fosfomycin resistance protein A (FosA) {Serratia m 87.52
d1jc4a_ 145 Methylmalonyl-CoA epimerase {Propionibacterium she 87.39
d1mpya1 145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 86.79
d1f1ua2 176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 86.65
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 86.47
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 84.87
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 84.7
d1qipa_ 176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 84.53
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 82.16
d1zhva266 Hypothetical protein Atu0741 {Agrobacterium tumefa 81.31
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 80.77
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 80.53
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Extradiol dioxygenases
domain: 4-hydroxyphenylpyruvate dioxygenase, HppD
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=4.9e-19  Score=97.76  Aligned_cols=94  Identities=13%  Similarity=0.192  Sum_probs=64.5

Q ss_pred             CceeEEEECCchhcHHHhhhccCCEEeeeeeCCCC--ceEEEeecCCCCccceeecccCCCC--------CCCCcceEEE
Q psy18055          1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAM--KFSLYFMGNWGTEKDEDLTYHNGNS--------DPRGFGHIGI   70 (95)
Q Consensus         1 l~hv~l~v~d~~~s~~FY~~~lg~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~g~~~i~f   70 (95)
                      ++||+|.|+|+++|++||+++|||++......+..  ....+.+..................        .+.|..|+||
T Consensus        12 ~dHi~i~V~Dl~~a~~fY~~~lGf~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~g~G~~hiaf   91 (149)
T d1sqia1          12 FHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSHVIKQGKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAF   91 (149)
T ss_dssp             EEEEEEECSCHHHHHHHHHHHHCCEEEEEESGGGTCCSEEEEEEEETTEEEEEEEESSTTCHHHHHHHHHHCSEEEEEEE
T ss_pred             EeEEEEEcCCHHHHHHHHhhccceEEEEEecccCCceEEEEEEecCCcEEEEEEeccCCCCchhhhhhhhCCCeEEEEEE
Confidence            58999999999999999999999998877543322  2223333322222211111111110        1245679999


Q ss_pred             EeCCHHHHHHHHHHcCCeeecCCC
Q psy18055         71 QVPDVTKACERFEQLGVEFVKKPN   94 (95)
Q Consensus        71 ~v~d~~~~~~~l~~~G~~~~~~p~   94 (95)
                      .|+|+++++++|+++|++++.+|.
T Consensus        92 ~V~di~~~~~~l~~~G~~~~~~P~  115 (149)
T d1sqia1          92 EVEDCEHIVQKARERGAKIVREPW  115 (149)
T ss_dssp             EEECHHHHHHHHHHHTCCEEEEEE
T ss_pred             EeccHHHHHHHHHHCCCEEccCCe
Confidence            999999999999999999998874



>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure