Psyllid ID: psy18055
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 95 | ||||||
| 307182233 | 705 | Tubulin-specific chaperone E [Camponotus | 1.0 | 0.134 | 0.653 | 6e-39 | |
| 380014619 | 711 | PREDICTED: tubulin-specific chaperone E- | 1.0 | 0.133 | 0.645 | 3e-38 | |
| 328786212 | 711 | PREDICTED: tubulin-specific chaperone E- | 1.0 | 0.133 | 0.645 | 3e-38 | |
| 350400723 | 746 | PREDICTED: tubulin-specific chaperone E- | 1.0 | 0.127 | 0.645 | 1e-37 | |
| 307210247 | 183 | Lactoylglutathione lyase [Harpegnathos s | 1.0 | 0.519 | 0.637 | 4e-37 | |
| 157133353 | 501 | lactoylglutathione lyase [Aedes aegypti] | 0.989 | 0.187 | 0.593 | 5e-36 | |
| 405963909 | 179 | Lactoylglutathione lyase [Crassostrea gi | 0.989 | 0.525 | 0.626 | 9e-36 | |
| 332374732 | 158 | unknown [Dendroctonus ponderosae] | 1.0 | 0.601 | 0.596 | 9e-35 | |
| 327262276 | 183 | PREDICTED: lactoylglutathione lyase-like | 1.0 | 0.519 | 0.588 | 1e-34 | |
| 165932331 | 184 | lactoylglutathione lyase [Mus musculus] | 1.0 | 0.516 | 0.596 | 1e-34 |
| >gi|307182233|gb|EFN69564.1| Tubulin-specific chaperone E [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 164 bits (415), Expect = 6e-39, Method: Compositional matrix adjust.
Identities = 81/124 (65%), Positives = 87/124 (70%), Gaps = 29/124 (23%)
Query: 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
MQQTMYRIKDPRKSLPFYT+VLGM+LL+KLDFP MKFSLYF+G
Sbjct: 28 MQQTMYRIKDPRKSLPFYTEVLGMTLLQKLDFPEMKFSLYFLGYENQKDIPTDKRESIEW 87
Query: 44 ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91
NWGTE D D YHNGNSDPRGFGHIGI VPDV KACERFE+L VEF+K
Sbjct: 88 TFSRKATIELTHNWGTETDPDAKYHNGNSDPRGFGHIGIAVPDVEKACERFEKLNVEFIK 147
Query: 92 KPND 95
KPND
Sbjct: 148 KPND 151
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380014619|ref|XP_003691323.1| PREDICTED: tubulin-specific chaperone E-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328786212|ref|XP_001120710.2| PREDICTED: tubulin-specific chaperone E-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350400723|ref|XP_003485937.1| PREDICTED: tubulin-specific chaperone E-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307210247|gb|EFN86897.1| Lactoylglutathione lyase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|157133353|ref|XP_001656216.1| lactoylglutathione lyase [Aedes aegypti] gi|108881553|gb|EAT45778.1| AAEL002957-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|405963909|gb|EKC29441.1| Lactoylglutathione lyase [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|332374732|gb|AEE62507.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|327262276|ref|XP_003215951.1| PREDICTED: lactoylglutathione lyase-like [Anolis carolinensis] | Back alignment and taxonomy information |
|---|
| >gi|165932331|ref|NP_079650.3| lactoylglutathione lyase [Mus musculus] gi|165932333|ref|NP_001107032.1| lactoylglutathione lyase [Mus musculus] gi|21362640|sp|Q9CPU0.3|LGUL_MOUSE RecName: Full=Lactoylglutathione lyase; AltName: Full=Aldoketomutase; AltName: Full=Glyoxalase I; Short=Glx I; AltName: Full=Ketone-aldehyde mutase; AltName: Full=Methylglyoxalase; AltName: Full=S-D-lactoylglutathione methylglyoxal lyase gi|196049696|pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin gi|196049697|pdb|2ZA0|B Chain B, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin gi|12832330|dbj|BAB22060.1| unnamed protein product [Mus musculus] gi|12834312|dbj|BAB22863.1| unnamed protein product [Mus musculus] gi|12836716|dbj|BAB23781.1| unnamed protein product [Mus musculus] gi|26327653|dbj|BAC27570.1| unnamed protein product [Mus musculus] gi|26340438|dbj|BAC33882.1| unnamed protein product [Mus musculus] gi|51859026|gb|AAH81432.1| Glyoxalase 1 [Mus musculus] gi|94962335|gb|ABF48483.1| glyoxalase I [Mus musculus] gi|94962337|gb|ABF48484.1| glyoxalase I [Mus musculus] gi|148676704|gb|EDL08651.1| glyoxalase 1 [Mus musculus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 95 | ||||||
| UNIPROTKB|F1N9Q2 | 190 | GLO1 "Uncharacterized protein" | 0.631 | 0.315 | 0.733 | 7.3e-38 | |
| MGI|MGI:95742 | 184 | Glo1 "glyoxalase 1" [Mus muscu | 0.631 | 0.326 | 0.716 | 2.4e-37 | |
| FB|FBgn0033162 | 176 | CG1707 [Drosophila melanogaste | 0.631 | 0.340 | 0.65 | 3.1e-37 | |
| RGD|2702 | 184 | Glo1 "glyoxalase 1" [Rattus no | 0.631 | 0.326 | 0.716 | 4e-37 | |
| UNIPROTKB|Q4R5F2 | 184 | GLO1 "Lactoylglutathione lyase | 0.631 | 0.326 | 0.716 | 8.2e-37 | |
| UNIPROTKB|J9NRV6 | 184 | GLO1 "Uncharacterized protein" | 0.631 | 0.326 | 0.7 | 1.3e-36 | |
| UNIPROTKB|I3LDM7 | 184 | GLO1 "Uncharacterized protein" | 0.631 | 0.326 | 0.7 | 2.7e-36 | |
| UNIPROTKB|A4FUZ1 | 184 | GLO1 "GLO1 protein" [Bos tauru | 0.631 | 0.326 | 0.683 | 2.7e-36 | |
| UNIPROTKB|Q5EI50 | 149 | Q5EI50 "GekBS101P" [Gekko japo | 0.631 | 0.402 | 0.733 | 3.5e-36 | |
| TAIR|locus:2205110 | 235 | AT1G08110 [Arabidopsis thalian | 0.547 | 0.221 | 0.754 | 1.2e-35 |
| UNIPROTKB|F1N9Q2 GLO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 246 (91.7 bits), Expect = 7.3e-38, Sum P(2) = 7.3e-38
Identities = 44/60 (73%), Positives = 50/60 (83%)
Query: 36 KFSLYFMGNWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPND 95
K +L NWGTE DE +YHNGNSDPRGFGHIGI VPDV KAC+RFE+LGV+FVKKP+D
Sbjct: 102 KATLELTHNWGTENDEKQSYHNGNSDPRGFGHIGIAVPDVNKACKRFEELGVKFVKKPDD 161
|
|
| MGI|MGI:95742 Glo1 "glyoxalase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033162 CG1707 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|2702 Glo1 "glyoxalase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R5F2 GLO1 "Lactoylglutathione lyase" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NRV6 GLO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDM7 GLO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4FUZ1 GLO1 "GLO1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5EI50 Q5EI50 "GekBS101P" [Gekko japonicus (taxid:146911)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205110 AT1G08110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 95 | |||
| PLN03042 | 185 | PLN03042, PLN03042, Lactoylglutathione lyase; Prov | 2e-55 | |
| PLN02367 | 233 | PLN02367, PLN02367, lactoylglutathione lyase | 2e-52 | |
| cd07233 | 121 | cd07233, Glyoxalase_I, Glyoxalase I catalyzes the | 7e-43 | |
| TIGR00068 | 150 | TIGR00068, glyox_I, lactoylglutathione lyase | 2e-41 | |
| pfam00903 | 120 | pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist | 3e-16 | |
| PRK10291 | 129 | PRK10291, PRK10291, glyoxalase I; Provisional | 8e-15 | |
| PLN02300 | 286 | PLN02300, PLN02300, lactoylglutathione lyase | 2e-14 | |
| PLN02300 | 286 | PLN02300, PLN02300, lactoylglutathione lyase | 9e-11 | |
| cd06587 | 110 | cd06587, Glo_EDI_BRP_like, This domain superfamily | 1e-09 | |
| pfam12681 | 109 | pfam12681, Glyoxalase_2, Glyoxalase-like domain | 5e-09 | |
| COG0346 | 138 | COG0346, GloA, Lactoylglutathione lyase and relate | 2e-05 | |
| cd07245 | 114 | cd07245, Glo_EDI_BRP_like_9, This conserved domain | 3e-05 | |
| cd08346 | 126 | cd08346, PcpA_N_like, N-terminal domain of Sphingo | 8e-05 | |
| cd07237 | 154 | cd07237, BphC1-RGP6_C_like, C-terminal domain of 2 | 0.001 | |
| cd07249 | 128 | cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | 0.002 |
| >gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
Score = 169 bits (429), Expect = 2e-55
Identities = 76/125 (60%), Positives = 85/125 (68%), Gaps = 30/125 (24%)
Query: 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
MQQTM+RIKDP+ SL FY++VLGMSLLK+LDFP MKFSLYF+G
Sbjct: 28 MQQTMFRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDSETAPTDPPERTVW 87
Query: 44 ------------NWGTEKDEDLT-YHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFV 90
NWGTE D + YHNGNSDPRGFGHIGI V DV KACERFE+LGVEFV
Sbjct: 88 TFGRKATIELTHNWGTESDPEFKGYHNGNSDPRGFGHIGITVDDVYKACERFEKLGVEFV 147
Query: 91 KKPND 95
KKP+D
Sbjct: 148 KKPDD 152
|
Length = 185 |
| >gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176661 cd07237, BphC1-RGP6_C_like, C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| PLN02367 | 233 | lactoylglutathione lyase | 99.83 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 99.8 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 99.76 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 99.74 | |
| cd08358 | 127 | Glo_EDI_BRP_like_21 This conserved domain belongs | 99.71 | |
| TIGR00068 | 150 | glyox_I lactoylglutathione lyase. Glyoxylase I is | 99.71 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 99.7 | |
| cd07257 | 153 | THT_oxygenase_C The C-terminal domain of 2,4,5-Tri | 99.7 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 99.7 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 99.7 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 99.68 | |
| cd07250 | 191 | HPPD_C_like C-terminal domain of 4-hydroxyphenylpy | 99.68 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 99.68 | |
| cd07243 | 143 | 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg | 99.68 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 99.68 | |
| PRK11478 | 129 | putative lyase; Provisional | 99.67 | |
| cd07247 | 114 | SgaA_N_like N-terminal domain of Streptomyces gris | 99.67 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 99.65 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 99.65 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.65 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 99.65 | |
| cd07264 | 125 | Glo_EDI_BRP_like_15 This conserved domain belongs | 99.64 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 99.63 | |
| KOG2944|consensus | 170 | 99.63 | ||
| cd08360 | 134 | MhqB_like_C C-terminal domain of Burkholderia sp. | 99.62 | |
| cd08343 | 131 | ED_TypeI_classII_C C-terminal domain of type I, cl | 99.62 | |
| cd08355 | 122 | Glo_EDI_BRP_like_14 This conserved domain belongs | 99.61 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 99.61 | |
| cd09014 | 166 | BphC-JF8_C_like C-terminal, catalytic, domain of B | 99.6 | |
| cd07256 | 161 | HPCD_C_class_II C-terminal domain of 3,4-dihydroxy | 99.6 | |
| cd07265 | 122 | 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg | 99.6 | |
| PF00903 | 128 | Glyoxalase: Glyoxalase/Bleomycin resistance protei | 99.6 | |
| PRK06724 | 128 | hypothetical protein; Provisional | 99.59 | |
| cd07258 | 141 | PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma | 99.58 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 99.58 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 99.57 | |
| cd07246 | 122 | Glo_EDI_BRP_like_8 This conserved domain belongs t | 99.57 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 99.56 | |
| cd07239 | 144 | BphC5-RK37_C_like C-terminal, catalytic, domain of | 99.55 | |
| PRK04101 | 139 | fosfomycin resistance protein FosB; Provisional | 99.55 | |
| cd07262 | 123 | Glo_EDI_BRP_like_19 This conserved domain belongs | 99.55 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 99.55 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 99.54 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 99.54 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.53 | |
| cd08364 | 131 | FosX FosX, a fosfomycin resistance protein, cataly | 99.53 | |
| COG3324 | 127 | Predicted enzyme related to lactoylglutathione lya | 99.53 | |
| cd09013 | 121 | BphC-JF8_N_like N-terminal, non-catalytic, domain | 99.53 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.53 | |
| cd08363 | 131 | FosB FosB, a fosfomycin resistance protein, cataly | 99.52 | |
| cd07244 | 121 | FosA FosA, a Fosfomycin resistance protein, cataly | 99.52 | |
| cd08362 | 120 | BphC5-RrK37_N_like N-terminal, non-catalytic, doma | 99.52 | |
| cd08361 | 124 | PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma | 99.52 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.52 | |
| cd09011 | 120 | Glo_EDI_BRP_like_23 This conserved domain belongs | 99.52 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 99.5 | |
| cd07240 | 117 | ED_TypeI_classII_N N-terminal domain of type I, cl | 99.5 | |
| cd08351 | 123 | ChaP_like ChaP, an enzyme involved in the biosynth | 99.5 | |
| cd07266 | 121 | HPCD_N_class_II N-terminal domain of 3,4-dihydroxy | 99.49 | |
| cd08359 | 119 | Glo_EDI_BRP_like_22 This conserved domain belongs | 99.49 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 99.48 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 99.46 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 99.46 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.45 | |
| cd07254 | 120 | Glo_EDI_BRP_like_20 This conserved domain belongs | 99.44 | |
| cd07238 | 112 | Glo_EDI_BRP_like_5 This conserved domain belongs t | 99.44 | |
| cd08357 | 125 | Glo_EDI_BRP_like_18 This conserved domain belongs | 99.44 | |
| cd07267 | 113 | THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr | 99.44 | |
| cd08354 | 122 | Glo_EDI_BRP_like_13 This conserved domain belongs | 99.44 | |
| cd08349 | 112 | BLMA_like Bleomycin binding protein (BLMA) and sim | 99.43 | |
| cd08345 | 113 | Fosfomycin_RP Fosfomycin resistant protein; inhibi | 99.42 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 99.41 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 99.4 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 99.4 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.38 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.38 | |
| cd09012 | 124 | Glo_EDI_BRP_like_24 This conserved domain belongs | 99.36 | |
| cd07261 | 114 | Glo_EDI_BRP_like_11 This conserved domain belongs | 99.36 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.34 | |
| cd08350 | 120 | BLMT_like BLMT, a bleomycin resistance protein enc | 99.33 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 99.28 | |
| cd08356 | 113 | Glo_EDI_BRP_like_17 This conserved domain belongs | 99.25 | |
| cd07251 | 121 | Glo_EDI_BRP_like_10 This conserved domain belongs | 99.21 | |
| KOG0638|consensus | 381 | 99.11 | ||
| COG3565 | 138 | Predicted dioxygenase of extradiol dioxygenase fam | 99.1 | |
| COG2764 | 136 | PhnB Uncharacterized protein conserved in bacteria | 99.05 | |
| cd06588 | 128 | PhnB_like Escherichia coli PhnB and similar protei | 98.98 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 98.95 | |
| KOG2943|consensus | 299 | 98.87 | ||
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 98.85 | |
| PF13468 | 175 | Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. | 98.82 | |
| KOG2943|consensus | 299 | 98.78 | ||
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 98.7 | |
| PRK01037 | 357 | trmD tRNA (guanine-N(1)-)-methyltransferase/unknow | 98.55 | |
| COG0346 | 138 | GloA Lactoylglutathione lyase and related lyases [ | 98.49 | |
| COG3607 | 133 | Predicted lactoylglutathione lyase [General functi | 98.48 | |
| PF14696 | 139 | Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H | 98.14 | |
| PRK10148 | 147 | hypothetical protein; Provisional | 98.1 | |
| KOG0638|consensus | 381 | 98.09 | ||
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 98.08 | |
| PF14506 | 125 | CppA_N: CppA N-terminal; PDB: 3E0R_D. | 97.77 | |
| PF06983 | 116 | 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans | 96.86 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 96.3 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 94.76 | |
| PF14507 | 101 | CppA_C: CppA C-terminal; PDB: 3E0R_D. | 94.33 | |
| PF06185 | 185 | YecM: YecM protein; InterPro: IPR010393 This famil | 94.08 | |
| PF15067 | 236 | FAM124: FAM124 family | 93.69 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 93.51 | |
| PRK11700 | 187 | hypothetical protein; Provisional | 93.41 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 92.34 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 91.81 | |
| cd07268 | 149 | Glo_EDI_BRP_like_4 This conserved domain belongs t | 91.58 | |
| KOG2944|consensus | 170 | 90.89 | ||
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 90.69 | |
| PRK11478 | 129 | putative lyase; Provisional | 89.01 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 88.92 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 88.08 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 87.53 | |
| PLN02367 | 233 | lactoylglutathione lyase | 87.3 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 87.04 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 86.81 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 86.61 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 86.5 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 86.4 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 85.93 | |
| KOG4657|consensus | 246 | 85.86 | ||
| cd07267 | 113 | THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr | 85.84 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 85.23 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 84.75 | |
| PF02208 | 47 | Sorb: Sorbin homologous domain; InterPro: IPR00312 | 83.02 | |
| cd07256 | 161 | HPCD_C_class_II C-terminal domain of 3,4-dihydroxy | 82.41 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 82.2 |
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
Probab=99.83 E-value=1.4e-19 Score=107.88 Aligned_cols=94 Identities=74% Similarity=1.227 Sum_probs=72.3
Q ss_pred CceeEEEECCchhcHHHhhhccCCEEeeeeeCCCCceEEEeecCCC-----------------Cccceee--ccc-----
Q psy18055 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWG-----------------TEKDEDL--TYH----- 56 (95)
Q Consensus 1 l~hv~l~v~d~~~s~~FY~~~lg~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~~~~~--~~~----- 56 (95)
|+|++|+|+|+++|++||+++|||++..+...+++.+.+++++..+ .....++ .+.
T Consensus 76 ~~HtmlRVkDle~Sl~FYt~vLGm~ll~r~d~pe~~f~lyFL~~~~~~~~p~d~~~r~~~~~~~~~~LELt~n~g~e~~~ 155 (233)
T PLN02367 76 MQQTMYRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPTDPTERTVWTFGQKATIELTHNWGTESDP 155 (233)
T ss_pred EEEEEEEeCCHHHHHHHHHHhcCCEEeEEEecCCCcEEEEEeecCCccccccccccceeeccCCCCEEEEecCCCCCccc
Confidence 5899999999999999999999999999888888888888875211 0111112 111
Q ss_pred ------CCCCCCCCcceEEEEeCCHHHHHHHHHHcCCeeecCCC
Q psy18055 57 ------NGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVKKPN 94 (95)
Q Consensus 57 ------~~~~~~~g~~~i~f~v~d~~~~~~~l~~~G~~~~~~p~ 94 (95)
.++..+.|.+|++|.|+|+++++++|+++|+++..+|.
T Consensus 156 ~~~~y~~gn~~p~G~~HIaf~VdDVdaa~erL~a~Gv~~v~~P~ 199 (233)
T PLN02367 156 DFKGYHNGNSEPRGFGHIGITVDDVYKACERFEELGVEFVKKPN 199 (233)
T ss_pred cchhcccCCCCCCCceEEEEEcCCHHHHHHHHHHCCCEEEeCCc
Confidence 11222357789999999999999999999999998774
|
|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR00068 glyox_I lactoylglutathione lyase | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >KOG2944|consensus | Back alignment and domain information |
|---|
| >cd08360 MhqB_like_C C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain | Back alignment and domain information |
|---|
| >cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein | Back alignment and domain information |
|---|
| >PRK06724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins | Back alignment and domain information |
|---|
| >PRK04101 fosfomycin resistance protein FosB; Provisional | Back alignment and domain information |
|---|
| >cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 | Back alignment and domain information |
|---|
| >COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin | Back alignment and domain information |
|---|
| >cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
| >cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins | Back alignment and domain information |
|---|
| >cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain | Back alignment and domain information |
|---|
| >cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins | Back alignment and domain information |
|---|
| >cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >KOG0638|consensus | Back alignment and domain information |
|---|
| >COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] | Back alignment and domain information |
|---|
| >COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2943|consensus | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B | Back alignment and domain information |
|---|
| >KOG2943|consensus | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3607 Predicted lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A | Back alignment and domain information |
|---|
| >PRK10148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0638|consensus | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function | Back alignment and domain information |
|---|
| >PF15067 FAM124: FAM124 family | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >PRK11700 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >KOG2944|consensus | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >KOG4657|consensus | Back alignment and domain information |
|---|
| >cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >PF02208 Sorb: Sorbin homologous domain; InterPro: IPR003127 Sorbin is an active peptide present in the digestive tract, where it has pro-absorptive and anti-secretory effects in different parts of the intestine, including the ability to decrease VIP (vasoactive intestinal peptide) and cholera toxin-induced secretion | Back alignment and domain information |
|---|
| >cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 95 | ||||
| 2za0_A | 184 | Crystal Structure Of Mouse Glyoxalase I Complexed W | 3e-37 | ||
| 3vw9_A | 187 | Human Glyoxalase I With An N-Hydroxypyridone Inhibi | 5e-36 | ||
| 1fro_A | 183 | Human Glyoxalase I With Benzyl-Glutathione Inhibito | 6e-36 | ||
| 1bh5_A | 183 | Human Glyoxalase I Q33e, E172q Double Mutant Length | 1e-35 | ||
| 1f9z_A | 135 | Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I | 5e-12 | ||
| 2c21_A | 144 | Specificity Of The Trypanothione-Dependednt Leishma | 9e-09 |
| >pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 | Back alignment and structure |
|
| >pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 | Back alignment and structure |
| >pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 | Back alignment and structure |
| >pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 | Back alignment and structure |
| >pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 | Back alignment and structure |
| >pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 95 | |||
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 3e-37 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 3e-35 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 1e-34 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 3e-23 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 6e-18 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 2e-17 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 1e-16 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 1e-15 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 2e-12 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 3e-12 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 8e-12 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 4e-10 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 6e-10 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 1e-09 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 3e-09 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 2e-08 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 5e-08 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 7e-08 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 1e-07 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-07 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 3e-07 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 3e-07 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 4e-07 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 1e-06 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 1e-06 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-06 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 1e-06 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 1e-06 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 1e-06 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 2e-06 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 2e-06 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 2e-06 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 3e-06 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 4e-06 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 4e-06 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 6e-06 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 7e-06 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 8e-06 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 9e-06 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 1e-05 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 1e-05 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 1e-05 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 1e-05 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 3e-05 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 3e-05 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 5e-05 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 8e-05 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 9e-05 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 1e-04 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 2e-04 |
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 | Back alignment and structure |
|---|
Score = 122 bits (308), Expect = 3e-37
Identities = 74/124 (59%), Positives = 86/124 (69%), Gaps = 29/124 (23%)
Query: 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
+QQTM RIKDP+KSL FYT+VLG++LL+KLDFPAMKFSLYF+
Sbjct: 32 LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAW 91
Query: 44 ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91
NWGTE DE +YHNGNSDPRGFGHIGI VPDV AC+RFE+LGV+FVK
Sbjct: 92 TFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVK 151
Query: 92 KPND 95
KP+D
Sbjct: 152 KPDD 155
|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 99.78 | |
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 99.77 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.77 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 99.75 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 99.74 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 99.74 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.74 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 99.73 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 99.72 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 99.71 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 99.7 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 99.7 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 99.69 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 99.69 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 99.65 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.65 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 99.64 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 99.64 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 99.63 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 99.62 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 99.61 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 99.61 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 99.61 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 99.61 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.61 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 99.6 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 99.6 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 99.59 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 99.58 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 99.57 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 99.57 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.57 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 99.56 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 99.56 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 99.56 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 99.55 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 99.54 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 99.54 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 99.53 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.53 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.53 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 99.53 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.52 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.52 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 99.52 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 99.51 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 99.51 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.51 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.5 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.5 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.49 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.49 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 99.49 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 99.49 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.48 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.48 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.48 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 99.48 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.47 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.46 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.46 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.46 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 99.45 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.44 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.44 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.44 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 99.44 | |
| 4gym_A | 149 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.44 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.43 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 99.43 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.43 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.42 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.42 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.42 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 99.42 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.42 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.42 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.41 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 99.41 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.41 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.41 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.41 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.41 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.4 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.4 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 99.4 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.38 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.38 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.36 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.34 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.33 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.32 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.3 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.29 | |
| 1u6l_A | 149 | Hypothetical protein; structural genomics, PSI, pr | 99.24 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.24 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.22 | |
| 1u7i_A | 136 | Hypothetical protein; structural genomics, PA1358, | 99.21 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.17 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 99.15 | |
| 3oms_A | 138 | PHNB protein; structural genomics, PSI-2, protein | 98.9 | |
| 3l20_A | 172 | Putative uncharacterized protein; hypothetical pro | 98.9 | |
| 1tsj_A | 139 | Conserved hypothetical protein; structural genomic | 98.83 | |
| 1u69_A | 163 | Hypothetical protein; structural genomics, MSCG, p | 98.19 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 98.16 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 97.12 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 97.1 | |
| 3opy_B | 941 | 6-phosphofructo-1-kinase beta-subunit; ATP binding | 96.12 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 95.02 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 92.06 | |
| 1k4n_A | 192 | Protein EC4020, protein YECM; structural genomics, | 90.24 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 88.96 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 88.3 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 87.79 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 85.82 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 85.75 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 85.46 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 85.41 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 85.32 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 84.86 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 83.79 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 83.1 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 82.93 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 82.71 | |
| 3iuz_A | 340 | Putative glyoxalase superfamily protein; struct ge | 80.74 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 80.41 |
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
Probab=99.78 E-value=1.7e-18 Score=94.20 Aligned_cols=93 Identities=17% Similarity=0.293 Sum_probs=65.9
Q ss_pred CceeEEEECCchhcHHHhhhccCCEEeeeeeCCCCceEEEeecCCCCccceeecccCCCC--------CCCCcceEEEEe
Q psy18055 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMGNWGTEKDEDLTYHNGNS--------DPRGFGHIGIQV 72 (95)
Q Consensus 1 l~hv~l~v~d~~~s~~FY~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~g~~~i~f~v 72 (95)
++|++|.|+|++++++||+++|||++......+.......++...+.............. ...+..|++|.|
T Consensus 6 i~hv~l~v~D~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~g~~hi~~~v 85 (134)
T 3rmu_A 6 LNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEV 85 (134)
T ss_dssp EEEEEEECSCHHHHHHHHHHTSCCEECCCEEEGGGTEEEEEEECSSSEEEEEEECSTTCTTHHHHHHCTTCEEEEEEEEE
T ss_pred eeeEEEEeCCHHHHHHHHHHhcCCEEeEeeecCCCCEEEEEEecCCEEEEEEecCCCCchhhhhhhccCCCCceEEEEEc
Confidence 579999999999999999999999988765444444455555543332222111111111 123456999999
Q ss_pred CCHHHHHHHHHHcCCeeecCC
Q psy18055 73 PDVTKACERFEQLGVEFVKKP 93 (95)
Q Consensus 73 ~d~~~~~~~l~~~G~~~~~~p 93 (95)
+|+++++++|+++|+++..+|
T Consensus 86 ~d~~~~~~~l~~~G~~~~~~~ 106 (134)
T 3rmu_A 86 DNINAAVMDLKKKKIRSLSEE 106 (134)
T ss_dssp SCHHHHHHHHHHTTCTTBCCC
T ss_pred CCHHHHHHHHHHcCCcccCCC
Confidence 999999999999999987764
|
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A | Back alignment and structure |
|---|
| >4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >3iuz_A Putative glyoxalase superfamily protein; struct genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: MLY P6G PGE; 1.90A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 95 | ||||
| d1qipa_ | 176 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 4e-16 | |
| d2c21a1 | 139 | d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion | 2e-09 | |
| d1twua_ | 137 | d.32.1.8 (A:) Hypothetical protein YycE {Bacillus | 3e-09 | |
| d1f9za_ | 135 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 2e-08 | |
| d1sqda1 | 167 | d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg | 1e-06 | |
| d1r9ca_ | 130 | d.32.1.2 (A:) Fosfomycin resistance protein FosX { | 2e-06 | |
| d1mpya2 | 162 | d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met | 2e-05 | |
| d1t47a1 | 163 | d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg | 2e-05 | |
| d1sp8a1 | 172 | d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg | 2e-05 | |
| d1npba_ | 140 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 3e-05 | |
| d1jc4a_ | 145 | d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion | 4e-05 | |
| d1zswa2 | 170 | d.32.1.10 (A:145-314) Hypothetical protein BC1024 | 6e-05 | |
| d2pjsa1 | 111 | d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 | 6e-05 | |
| d1nkia_ | 134 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 3e-04 | |
| d1xrka_ | 120 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 5e-04 | |
| d1zswa1 | 144 | d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B | 0.001 | |
| d1cjxa2 | 203 | d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy | 0.002 |
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Glyoxalase I (lactoylglutathione lyase) domain: Glyoxalase I (lactoylglutathione lyase) species: Human (Homo sapiens) [TaxId: 9606]
Score = 67.3 bits (163), Expect = 4e-16
Identities = 71/124 (57%), Positives = 84/124 (67%), Gaps = 29/124 (23%)
Query: 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAMKFSLYFMG----------------- 43
+QQTM R+KDP+KSL FYT+VLGM+L++K DFP MKFSLYF+
Sbjct: 24 LQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAW 83
Query: 44 ------------NWGTEKDEDLTYHNGNSDPRGFGHIGIQVPDVTKACERFEQLGVEFVK 91
NWGTE DE +YHNGNSDPRGFGHIGI VPDV AC+RFE+LGV+FVK
Sbjct: 84 ALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVK 143
Query: 92 KPND 95
KP+D
Sbjct: 144 KPDD 147
|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.76 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.75 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.75 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 99.74 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.72 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 99.71 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 99.7 | |
| d2i7ra1 | 115 | Hypotheical protein SP0731 {Streptococcus pneumoni | 99.69 | |
| d1mpya2 | 162 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.68 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 99.67 | |
| d1twua_ | 137 | Hypothetical protein YycE {Bacillus subtilis [TaxI | 99.66 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.65 | |
| d1f9za_ | 135 | Glyoxalase I (lactoylglutathione lyase) {Escherich | 99.65 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.64 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.63 | |
| d1r9ca_ | 130 | Fosfomycin resistance protein FosX {Mesorhizobium | 99.62 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.62 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.61 | |
| d1cjxa2 | 203 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.6 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 99.6 | |
| d1f1ua1 | 146 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.57 | |
| d2pjsa1 | 111 | Uncharacterized protein Atu1953 {Agrobacterium tum | 99.57 | |
| d1nkia_ | 134 | Fosfomycin resistance protein A (FosA) {Pseudomona | 99.55 | |
| d2c21a1 | 139 | Glyoxalase I (lactoylglutathione lyase) {Leishmani | 99.54 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.53 | |
| d1mpya1 | 145 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.52 | |
| d1sp8a2 | 224 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.49 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 99.48 | |
| d1t47a2 | 199 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.47 | |
| d1sqia2 | 210 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.47 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.46 | |
| d1xy7a_ | 135 | Hypothetical protein At5g48480 {Thale cress (Arabi | 99.28 | |
| d1sqda2 | 230 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.24 | |
| d1ecsa_ | 120 | Bleomycin resistance protein, BRP {Klebsiella pneu | 99.2 | |
| d1jifa_ | 122 | Bleomycin resistance protein, BRP {Streptomyces ve | 99.16 | |
| d1xrka_ | 120 | Bleomycin resistance protein, BRP {Streptoalloteic | 99.01 | |
| d1u6la_ | 137 | Hypothetical protein PA1353 {Pseudomonas aeruginos | 98.8 | |
| d1u7ia_ | 134 | Hypothetical protein PA1358 {Pseudomonas aeruginos | 98.55 | |
| d1tsja_ | 129 | Hypothetical protein MW1090 {Staphylococcus aureus | 97.6 | |
| d1u69a_ | 156 | Hypothetical protein PA2721 {Pseudomonas aeruginos | 97.29 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 94.96 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 94.38 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 93.64 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 93.04 | |
| d1k4na_ | 190 | Hypothetical protein YecM (EC4020) {Escherichia co | 92.7 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 91.75 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 91.29 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 91.05 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 90.9 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 90.86 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 90.04 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 89.91 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 89.79 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 88.81 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 87.52 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 87.39 | |
| d1mpya1 | 145 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 86.79 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 86.65 | |
| d1cjxa2 | 203 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 86.47 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 84.87 | |
| d1sp8a2 | 224 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 84.7 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 84.53 | |
| d1sqda2 | 230 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 82.16 | |
| d1zhva2 | 66 | Hypothetical protein Atu0741 {Agrobacterium tumefa | 81.31 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 80.77 | |
| d1sqia2 | 210 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 80.53 |
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Extradiol dioxygenases domain: 4-hydroxyphenylpyruvate dioxygenase, HppD species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76 E-value=4.9e-19 Score=97.76 Aligned_cols=94 Identities=13% Similarity=0.192 Sum_probs=64.5
Q ss_pred CceeEEEECCchhcHHHhhhccCCEEeeeeeCCCC--ceEEEeecCCCCccceeecccCCCC--------CCCCcceEEE
Q psy18055 1 MQQTMYRIKDPRKSLPFYTKVLGMSLLKKLDFPAM--KFSLYFMGNWGTEKDEDLTYHNGNS--------DPRGFGHIGI 70 (95)
Q Consensus 1 l~hv~l~v~d~~~s~~FY~~~lg~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~g~~~i~f 70 (95)
++||+|.|+|+++|++||+++|||++......+.. ....+.+.................. .+.|..|+||
T Consensus 12 ~dHi~i~V~Dl~~a~~fY~~~lGf~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~g~G~~hiaf 91 (149)
T d1sqia1 12 FHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSHVIKQGKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAF 91 (149)
T ss_dssp EEEEEEECSCHHHHHHHHHHHHCCEEEEEESGGGTCCSEEEEEEEETTEEEEEEEESSTTCHHHHHHHHHHCSEEEEEEE
T ss_pred EeEEEEEcCCHHHHHHHHhhccceEEEEEecccCCceEEEEEEecCCcEEEEEEeccCCCCchhhhhhhhCCCeEEEEEE
Confidence 58999999999999999999999998877543322 2223333322222211111111110 1245679999
Q ss_pred EeCCHHHHHHHHHHcCCeeecCCC
Q psy18055 71 QVPDVTKACERFEQLGVEFVKKPN 94 (95)
Q Consensus 71 ~v~d~~~~~~~l~~~G~~~~~~p~ 94 (95)
.|+|+++++++|+++|++++.+|.
T Consensus 92 ~V~di~~~~~~l~~~G~~~~~~P~ 115 (149)
T d1sqia1 92 EVEDCEHIVQKARERGAKIVREPW 115 (149)
T ss_dssp EEECHHHHHHHHHHHTCCEEEEEE
T ss_pred EeccHHHHHHHHHHCCCEEccCCe
Confidence 999999999999999999998874
|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|