Diaphorina citri psyllid: psy18061


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MASNLEEEQSLRECEEYVQQHNVQQMLKDCIVQLCVTKPDNPISFLREYFQKLERFPIFS
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccc
************ECEEYVQQHNVQQMLKDCIVQLCVTKPDNPISFLREYFQKLERFP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNLEEEQSLRECEEYVQQHNVQQMLKDCIVQLCVTKPDNPISFLREYFQKLERFPIFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
cAMP-dependent protein kinase type I regulatory subunit confidentP16905
cAMP-dependent protein kinase type I-alpha regulatory subunit Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.confidentQ9DBC7
cAMP-dependent protein kinase type I-alpha regulatory subunit Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.confidentP00514

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0045859 [BP]regulation of protein kinase activityprobableGO:0042325, GO:0032268, GO:0019220, GO:0019222, GO:0050790, GO:0060255, GO:0051246, GO:0043549, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0065009, GO:0001932, GO:0050789, GO:0080090
GO:0005952 [CC]cAMP-dependent protein kinase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008603 [MF]cAMP-dependent protein kinase regulator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0019887
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0007611 [BP]learning or memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007610, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0016020 [CC]membraneprobableGO:0005575
GO:0030552 [MF]cAMP bindingprobableGO:0043168, GO:0030551, GO:0030554, GO:0097159, GO:0003674, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032555, GO:0017076, GO:0000166, GO:1901363, GO:1901265, GO:0005488
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F9K, chain A
Confidence level:very confident
Coverage over the Query: 12-57
View the alignment between query and template
View the model in PyMOL