Diaphorina citri psyllid: psy18070


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MSLTGIMVKFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKDIDRTITHKKYIGITMLTLNEKLIEQLRRDRHIPYDLTHGVLIWRVMYNSPAYFIKFRTSAGIKPTSSRLLGECLAQYTTSKLVVWSINHPSITCHILLRLYLLVCSELTKFLS
cccccccccccccccccccccccEEEEEEEcccccCEEEEcHHHHHHHHHHHHHccccccCEEccEEEEEEEEccHHHHHHHHccccccccccccEEEEEEccccHHHHcccccccCEECcccccccHHccccccccEEEEcccccccCEEEEEEEEEEEccccccccc
MSLTGIMVKFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKDIDRTITHKKYIGITMLTLNEKLIEQLRRDRHIPYDLTHGVLIWRVMYNSPAYFIKFRTSAGIKPTSSRLLGECLAQYTTSKLVVWSINHPSITCHILLRLYLLVCSEL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLTGIMVKFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKDIDRTITHKKYIGITMLTLNEKLIEQLRRDRHIPYDLTHGVLIWRVMYNSPAYFIKFRTSAGIKPTSSRLLGECLAQYTTSKLVVWSINHPSITCHILLRLYLLVCSELTKFLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine protease HTRA2, mitochondrial Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.confidentQ9VFJ3
Serine protease HTRA2, mitochondrial Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.confidentQ297U2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030512 [BP]negative regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0008236 [MF]serine-type peptidase activityprobableGO:0016787, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0030514 [BP]negative regulation of BMP signaling pathwayprobableGO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LCY, chain A
Confidence level:very confident
Coverage over the Query: 1-51,65-156
View the alignment between query and template
View the model in PyMOL