Diaphorina citri psyllid: psy18074


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MEAFVFTAANEDFNLYSYDIRQLNSPLNVHKDMTSAVTSVDYSPTGREFVAGGYDKSLRLYLAHQGHSRDIYHTKRMQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLGYVNNKQRQALDYSESLKQKYAHHPQIRRIARHRQVPRHIYNAQAEHRAIRSKQKRKESNKRTHSAPGTVPQTKERQRAVVKEME
ccccEEEEECccccEEEEEcccccccccccccccccEEEEECcccccEEEEECccccEEEEEccccCEEccccccccccEEEEEEcccccEEEEccccccEEEEEccccccccccccccccccccccccEEEEEEcccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccccccccc
MEAFVFTAANEDFNLYSYDIRQLNSPLNVHKDMTSAVTSVDYSPTGREFVAGGYDKSLRLYLAHQGHSRDIYHTKRMQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLGYVNN**RQALDYSESLKQKYAHHPQIRRIARHRQVPRHIYN*******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAFVFTAANEDFNLYSYDIRQLNSPLNVHKDMTSAVTSVDYSPTGREFVAGGYDKSLRLYLAHQGHSRDIYHTKRMQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLGYVNNKQRQALDYSESLKQKYAHHPQIRRIARHRQVPRHIYNAQAEHRAIRSKQKRKESNKRTHSAPGTVPQTKERQRAVVKEME

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DDB1- and CUL4-associated factor 13 Possible role in ribosomal RNA processing. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.confidentQ5R4T8
DDB1- and CUL4-associated factor 13 Possible role in ribosomal RNA processing. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.confidentQ6PAC3
DDB1- and CUL4-associated factor 13 Possible role in ribosomal RNA processing. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.confidentQ5ZLK1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0080008 [CC]Cul4-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NR0, chain A
Confidence level:confident
Coverage over the Query: 4-158
View the alignment between query and template
View the model in PyMOL
Template: 4H5I, chain A
Confidence level:confident
Coverage over the Query: 2-181
View the alignment between query and template
View the model in PyMOL