Diaphorina citri psyllid: psy18087


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQLTDGED
cHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccccccccccccccc
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSH*Q******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQLTDGED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras GTPase-activating-like protein IQGAP2 Binds to activated CDC42 and RAC1 but does not seem to stimulate their GTPase activity. Associates with calmodulin.confidentQ3UQ44
Ras GTPase-activating-like protein IQGAP2 Binds to activated CDC42 and RAC1 but does not seem to stimulate their GTPase activity. Associates with calmodulin.confidentQ13576

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0017016 [MF]Ras GTPase bindingprobableGO:0019899, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0071277 [BP]cellular response to calcium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0051592, GO:0044763, GO:0008150, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0005902 [CC]microvillusprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RR8, chain A
Confidence level:very confident
Coverage over the Query: 1-68
View the alignment between query and template
View the model in PyMOL