Psyllid ID: psy18087


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70----
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQLTDGED
cHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEcccccccccccccccccccc
ccEEHHHHHcccccccHHHHHHHHcHHHHHHHHHHcccccccccEEEcHHHHHHHHccccccEEEccccccccc
MSIWIEsciketlppstelesnLRNGIVLAKLghyldpemvpeskiydadFAVYNRVAEKTemlshtqltdged
msiwiesciketlppstelESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTemlshtqltdged
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQLTDGED
**IWIESCIKET********SNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVA****************
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSH*Q******
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEML**********
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQLTDG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQLTDGED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query74 2.2.26 [Sep-21-2011]
Q3UQ44 1575 Ras GTPase-activating-lik yes N/A 0.716 0.033 0.528 5e-11
Q13576 1575 Ras GTPase-activating-lik yes N/A 0.716 0.033 0.528 5e-11
P46940 1657 Ras GTPase-activating-lik no N/A 0.689 0.030 0.529 8e-11
Q9JKF1 1657 Ras GTPase-activating-lik no N/A 0.689 0.030 0.529 9e-11
Q86VI3 1631 Ras GTPase-activating-lik no N/A 0.635 0.028 0.574 2e-10
>sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 Back     alignment and function desciption
 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 36/53 (67%)

Query: 4   WIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNR 56
           W+E C+ E LPP+TELE  LRNG+ LAKL  +  P+MV E KIYD +   Y +
Sbjct: 50  WMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKK 102




Binds to activated CDC42 and RAC1 but does not seem to stimulate their GTPase activity. Associates with calmodulin.
Mus musculus (taxid: 10090)
>sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 Back     alignment and function description
>sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 Back     alignment and function description
>sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
443697139 1626 hypothetical protein CAPTEDRAFT_159655 [ 0.702 0.031 0.596 2e-12
307213454 1605 Ras GTPase-activating-like protein IQGAP 0.743 0.034 0.527 3e-12
405957030 1627 Ras GTPase-activating-like protein IQGAP 0.689 0.031 0.607 3e-12
345494780 1618 PREDICTED: ras GTPase-activating-like pr 0.689 0.031 0.568 9e-12
332017840 1644 Ras GTPase-activating-like protein IQGAP 0.689 0.031 0.568 3e-11
340709109 1620 PREDICTED: LOW QUALITY PROTEIN: ras GTPa 0.743 0.033 0.545 4e-11
350419289 1626 PREDICTED: ras GTPase-activating-like pr 0.743 0.033 0.527 1e-10
380028521 1636 PREDICTED: LOW QUALITY PROTEIN: ras GTPa 0.743 0.033 0.527 1e-10
291232521 1655 PREDICTED: IQ motif containing GTPase ac 0.702 0.031 0.557 1e-10
4966251 1448 IQGAP [Hydra vulgaris] 0.702 0.035 0.538 1e-10
>gi|443697139|gb|ELT97684.1| hypothetical protein CAPTEDRAFT_159655 [Capitella teleta] Back     alignment and taxonomy information
 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 41/52 (78%)

Query: 3  IWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVY 54
          +WIE+CIKETLP +TELE  LRNG+ LAKL HY++ E+VP  +I+D D + Y
Sbjct: 22 VWIEACIKETLPATTELEEGLRNGVALAKLAHYINSELVPLKRIFDRDESRY 73




Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota

>gi|307213454|gb|EFN88876.1| Ras GTPase-activating-like protein IQGAP1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|405957030|gb|EKC23268.1| Ras GTPase-activating-like protein IQGAP1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|345494780|ref|XP_001603513.2| PREDICTED: ras GTPase-activating-like protein IQGAP1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332017840|gb|EGI58500.1| Ras GTPase-activating-like protein IQGAP1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340709109|ref|XP_003393156.1| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating-like protein IQGAP1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350419289|ref|XP_003492132.1| PREDICTED: ras GTPase-activating-like protein IQGAP1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380028521|ref|XP_003697947.1| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating-like protein IQGAP1-like [Apis florea] Back     alignment and taxonomy information
>gi|291232521|ref|XP_002736212.1| PREDICTED: IQ motif containing GTPase activating protein 1-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|4966251|gb|AAD33755.2| IQGAP [Hydra vulgaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
UNIPROTKB|E1B946 1636 IQGAP3 "Uncharacterized protei 0.635 0.028 0.595 5.7e-10
UNIPROTKB|F6Y6X6 1471 IQGAP3 "Uncharacterized protei 0.635 0.031 0.595 6.4e-10
UNIPROTKB|D6R939 825 IQGAP2 "Ras GTPase-activating- 0.716 0.064 0.528 6.5e-10
UNIPROTKB|E2R3E7 1634 IQGAP3 "Uncharacterized protei 0.635 0.028 0.595 7.3e-10
ZFIN|ZDB-GENE-030131-2878 1680 iqgap2 "IQ motif containing GT 0.689 0.030 0.529 7.5e-10
UNIPROTKB|F1NY82 1663 IQGAP1 "Uncharacterized protei 0.689 0.030 0.529 1.2e-09
UNIPROTKB|F1MTR1 1548 IQGAP2 "Uncharacterized protei 0.716 0.034 0.528 1.4e-09
UNIPROTKB|F1PSQ0 1548 IQGAP2 "Uncharacterized protei 0.716 0.034 0.528 1.4e-09
UNIPROTKB|Q13576 1575 IQGAP2 "Ras GTPase-activating- 0.716 0.033 0.528 1.4e-09
MGI|MGI:2449975 1575 Iqgap2 "IQ motif containing GT 0.716 0.033 0.528 1.4e-09
UNIPROTKB|E1B946 IQGAP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 158 (60.7 bits), Expect = 5.7e-10, P = 5.7e-10
 Identities = 28/47 (59%), Positives = 36/47 (76%)

Query:     4 WIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDAD 50
             W+E+C+KE LP   ELE +LRNG++LAKLGH   P +VP  KIYDA+
Sbjct:    43 WMEACLKEELPSPVELEESLRNGVLLAKLGHCFAPSVVPLKKIYDAE 89




GO:0071310 "cellular response to organic substance" evidence=IEA
GO:0070371 "ERK1 and ERK2 cascade" evidence=IEA
GO:0033601 "positive regulation of mammary gland epithelial cell proliferation" evidence=IEA
GO:0017048 "Rho GTPase binding" evidence=IEA
GO:0016328 "lateral plasma membrane" evidence=IEA
GO:0010629 "negative regulation of gene expression" evidence=IEA
GO:0010628 "positive regulation of gene expression" evidence=IEA
GO:0008361 "regulation of cell size" evidence=IEA
GO:0007265 "Ras protein signal transduction" evidence=IEA
GO:0005911 "cell-cell junction" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0000187 "activation of MAPK activity" evidence=IEA
GO:0000082 "G1/S transition of mitotic cell cycle" evidence=IEA
GO:0005099 "Ras GTPase activator activity" evidence=IEA
UNIPROTKB|F6Y6X6 IQGAP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6R939 IQGAP2 "Ras GTPase-activating-like protein IQGAP2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3E7 IQGAP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2878 iqgap2 "IQ motif containing GTPase activating protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY82 IQGAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTR1 IQGAP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSQ0 IQGAP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q13576 IQGAP2 "Ras GTPase-activating-like protein IQGAP2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2449975 Iqgap2 "IQ motif containing GTPase activating protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3UQ44IQGA2_MOUSENo assigned EC number0.52830.71620.0336yesN/A
Q13576IQGA2_HUMANNo assigned EC number0.52830.71620.0336yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 5e-06
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 1e-05
smart00033101 smart00033, CH, Calponin homology domain 2e-05
COG5261 1054 COG5261, IQG1, Protein involved in regulation of c 4e-04
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
 Score = 40.3 bits (95), Expect = 5e-06
 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 4  WIESCIKETLP-PSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADF-AVYN 55
          WI   + E    P T    +LR+G+ L  L + L P ++   K+    F  + N
Sbjct: 7  WINEVLGEYGGLPVTNFFEDLRDGLALCALLNKLRPGLIDLKKVNKNRFDKLEN 60


The CH domain is found in both cytoskeletal proteins and signal transduction proteins. The CH domain is involved in actin binding in some members of the family. However in calponins there is evidence that the CH domain is not involved in its actin binding activity. Most member proteins have from two to four copies of the CH domain, however some proteins such as calponin have only a single copy. Length = 104

>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|227586 COG5261, IQG1, Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 74
KOG2046|consensus193 99.67
KOG2128|consensus 1401 99.58
COG5199178 SCP1 Calponin [Cytoskeleton] 99.44
cd00014107 CH Calponin homology domain; actin-binding domain 99.29
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 99.22
smart00033103 CH Calponin homology domain. Actin binding domains 99.17
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.04
KOG2996|consensus 865 97.82
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 97.68
KOG0532|consensus722 97.59
KOG0046|consensus 627 96.87
KOG0046|consensus 627 95.51
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 87.54
>KOG2046|consensus Back     alignment and domain information
Probab=99.67  E-value=2e-17  Score=117.48  Aligned_cols=58  Identities=26%  Similarity=0.457  Sum_probs=49.9

Q ss_pred             ChhHHHHHhccCCCCchHHHHhhhhhHHHHHhhhhhCCCCcccccccCCCcccccccCCccccccccC
Q psy18087          1 MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQ   68 (74)
Q Consensus         1 ik~WIe~vlge~l~~~~~~~e~LkdGvvLckL~N~l~P~~v~~kkI~~~~~~~~k~sg~~F~~~~~~~   68 (74)
                      +++||+.++..+.+...+|+++|||||+||+|+|+|+|++++  +++        .|.|+|..||||.
T Consensus        30 l~~WI~~~~~~~~~~~~~f~~~LKDG~iLCkl~N~l~p~~~~--~~~--------~s~~~f~qmEnIs   87 (193)
T KOG2046|consen   30 LREWIENVVLTELPARGDFQDLLKDGVILCKLINKLYPGVVK--KIN--------ESKMAFVQMENIS   87 (193)
T ss_pred             HHHHHHHhhccCCCcccCHHHHHcchHHHHHHHHHhCcCccc--ccc--------cccccHHHHHHHH
Confidence            478999987777765569999999999999999999997774  555        7899999999984



>KOG2128|consensus Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
3i6x_A193 Crystal Structure Of The Calponin Homology Domain O 2e-11
2rr8_A190 Solution Structure Of Calponin Homology Domain Of I 2e-11
1p5s_A203 Structure And Function Of The Calponin-Homology Dom 5e-04
1p2x_A159 Crystal Structure Of The Calponin-Homology Domain O 7e-04
>pdb|3I6X|A Chain A, Crystal Structure Of The Calponin Homology Domain Of Iqgap1 Length = 193 Back     alignment and structure

Iteration: 1

Score = 64.3 bits (155), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 27/51 (52%), Positives = 37/51 (72%) Query: 4 WIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVY 54 W+E+C+ E LPP+TELE LRNG+ LAKLG++ P++V KIYD + Y Sbjct: 55 WMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRY 105
>pdb|2RR8|A Chain A, Solution Structure Of Calponin Homology Domain Of Iqgap1 Length = 190 Back     alignment and structure
>pdb|1P5S|A Chain A, Structure And Function Of The Calponin-Homology Domain Of An Iqgap Protein From Schizosaccharomyces Pombe Length = 203 Back     alignment and structure
>pdb|1P2X|A Chain A, Crystal Structure Of The Calponin-Homology Domain Of Rng2 From Schizosaccharomyces Pombe Length = 159 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query74
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 3e-13
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 5e-13
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 1e-11
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 3e-11
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 1e-09
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 4e-07
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 7e-07
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 7e-06
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 8e-06
1ujo_A144 Transgelin; CH domain, actin binding, structural g 3e-05
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 2e-04
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Length = 193 Back     alignment and structure
 Score = 60.4 bits (146), Expect = 3e-13
 Identities = 27/52 (51%), Positives = 37/52 (71%)

Query: 4   WIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYN 55
           W+E+C+ E LPP+TELE  LRNG+ LAKLG++  P++V   KIYD +   Y 
Sbjct: 55  WMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYK 106


>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 136 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 146 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 99.87
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 99.86
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 99.81
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.8
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 99.78
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 99.77
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 99.77
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 99.76
1ujo_A144 Transgelin; CH domain, actin binding, structural g 99.76
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.75
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.72
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.45
2qjz_A123 Microtubule-associated protein RP/EB family member 99.4
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 99.34
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.24
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 99.03
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.0
1wku_A 254 Alpha-actinin 3; calponin homology domain, actin b 98.99
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 98.94
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 98.77
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 98.56
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 98.52
3f7p_A 296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 98.52
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 98.44
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 98.41
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 98.41
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 98.17
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 98.09
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 97.65
2r8u_A 268 Microtubule-associated protein RP/EB family member 97.19
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 96.29
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 96.19
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 96.05
2d88_A121 Protein mical-3; all alpha, calponin homology doma 95.98
1wyl_A116 NEDD9 interacting protein with calponin homology a 95.84
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 95.76
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 95.65
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 95.56
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 95.17
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 95.0
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 94.8
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 94.79
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 94.7
1bhd_A118 Utrophin; calponin homology, actin binding, struct 94.65
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 94.52
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 93.88
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 92.05
3hoc_A272 Filamin-A; calponin homology domain, actin binding 91.6
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 91.56
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.87  E-value=2.3e-23  Score=145.51  Aligned_cols=68  Identities=40%  Similarity=0.742  Sum_probs=64.2

Q ss_pred             ChhHHHHHhccCCCCchHHHHhhhhhHHHHHhhhhhCCCCcccccccCCCcccccccCCccccccccC
Q psy18087          1 MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQ   68 (74)
Q Consensus         1 ik~WIe~vlge~l~~~~~~~e~LkdGvvLckL~N~l~P~~v~~kkI~~~~~~~~k~sg~~F~~~~~~~   68 (74)
                      +++||++++|+++|+.++|+++|||||+||+|+|+|+|+++|.+||+++++.+|+.++++|++||||+
T Consensus        52 ~~~WIe~~lg~~l~~~~~l~~~LrdGvvLCkL~N~l~Pg~vp~kkI~~~~~~~~~~~~~~F~~~eNI~  119 (193)
T 3i6x_A           52 AKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVI  119 (193)
T ss_dssp             HHHHHHHHHSSCCCCGGGHHHHHTTSHHHHHHHHHHCTTTCCGGGSTTTTCHHHHHSCCCGGGHHHHH
T ss_pred             HHHHHHHHhCCCCCChHHHHHHhccHHHHHHHHHHHCCCCCCccccCCcccccccCcccchHHHHHHH
Confidence            47899999999999877999999999999999999999999989999988889999999999999985



>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 74
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 3e-07
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 2e-06
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 4e-06
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Ras GTPase-activating-like protein rng2
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
 Score = 42.7 bits (100), Expect = 3e-07
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 4  WIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVP 42
          WIE C+   L P++  E +LRNG+VLA L     P+ + 
Sbjct: 19 WIEECLGTDLGPTSTFEQSLRNGVVLALLVQKFQPDKLI 57


>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 99.8
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.68
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.41
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 97.96
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 97.93
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 97.67
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 97.63
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 97.55
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 97.42
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 97.37
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 96.66
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 96.65
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 96.59
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 96.49
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 96.35
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Calponin
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.80  E-value=3.1e-21  Score=122.73  Aligned_cols=56  Identities=21%  Similarity=0.438  Sum_probs=50.8

Q ss_pred             ChhHHHHHhccCCCCchHHHHhhhhhHHHHHhhhhhCCCCcccccccCCCcccccccCCccccccccC
Q psy18087          1 MSIWIESCIKETLPPSTELESNLRNGIVLAKLGHYLDPEMVPESKIYDADFAVYNRVAEKTEMLSHTQ   68 (74)
Q Consensus         1 ik~WIe~vlge~l~~~~~~~e~LkdGvvLckL~N~l~P~~v~~kkI~~~~~~~~k~sg~~F~~~~~~~   68 (74)
                      ++.|||+++|+++++  +|+++|||||+||+|+|+|+||+++  ||+        .++++|+++|||+
T Consensus         8 ~~~Wie~~~~~~~~~--~~~~~L~dGv~LC~L~N~l~pg~i~--ki~--------~~~~~f~~~eNI~   63 (108)
T d1h67a_           8 LRVWIEGATGRRIGD--NFMDGLKDGVILCELINKLQPGSVQ--KVN--------DPVQNWHKLENIG   63 (108)
T ss_dssp             HHHHHHHHHSCCCCS--CHHHHHHHCSHHHHHHHHHSTTSST--TCC--------CTTSSHHHHHHHH
T ss_pred             HHHHHHHHhCCCCch--HHHHHHcCchhHHHHHHHHHhcCCC--ccC--------CCcchhHHHHHHH
Confidence            478999999999986  8999999999999999999999996  666        5688999999985



>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure