Diaphorina citri psyllid: psy18091

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
cccEEEEEEcccccEEEEccccccEEEccccccccccccccccEEEccccccEEEEEEcccccEEEEECccccEEEEEccccccEEEEcccccccccccEEEEEEcccccEEEEECccccEEEEcccccCEEEccccccccccEEEEEEcccccEEEEECccccEEEEEcccccccEEccccccccccEEEEEEcccccEEEEECccccEEEEEccccccccccccccccccccEEEEEEcccccEEEEECccccEEEccccccccccccccccccccEEEEEEEcccccccEEEEEEcccccEEEEccccccEEEEEcccccccccccccCEEccccccccccEEEEEEccccccEEEEECccccEEEEEcccccc
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLEN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cytosolic iron-sulfur protein assembly protein Ciao1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.very confidentQ7PS24
Probable cytosolic iron-sulfur protein assembly protein CIAO1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.very confidentQ5M7T1
Probable cytosolic iron-sulfur protein assembly protein Ciao1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.very confidentQ292E8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processconfident
GO:0071817 [CC]MMXD complexconfidentGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0097361 [CC]CIA complexconfidentGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0016226 [BP]iron-sulfur cluster assemblyprobableGO:0022607, GO:0009058, GO:0016043, GO:0031163, GO:0044085, GO:0008150, GO:0008152, GO:0071840
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0007059 [BP]chromosome segregationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0016573 [BP]histone acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005694 [CC]chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0004402 [MF]histone acetyltransferase activityprobableGO:0008080, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0000123 [CC]histone acetyltransferase complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000055 [BP]ribosomal large subunit export from nucleusprobableGO:0051169, GO:0051168, GO:0033750, GO:0033753, GO:0071166, GO:0051656, GO:0071840, GO:0042254, GO:0044699, GO:0022613, GO:0016482, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0071426, GO:0046907, GO:0071428, GO:0000054, GO:0044085, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0002098 [BP]tRNA wobble uridine modificationprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0008033, GO:0009987, GO:0006725, GO:0002097, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0006396
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 43-374
View the alignment between query and template
View the model in PyMOL
Template: 2W18, chain A
Confidence level:confident
Coverage over the Query: 31-264,280-373
View the alignment between query and template
View the model in PyMOL