Psyllid ID: psy18091


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
cccEEEEEEcccccEEEEccccccEEEccccccccccccccccEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccccEEEEcccccccccccEEEEEEcccccEEEEEEccccEEEEcccccEEEEccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccccccEEEEEEcccccEEEEEEccccEEEccccccccccccccccccccEEEEEEEcccccccEEEEEEcccccEEEEccccccEEEEEcccccccccccccEEEccccccccccEEEEEEccccccEEEEEEccccEEEEEcccccc
cccEEEEEEcccccEEEEEccccEEEEEEccccccccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEEcccccccccEEEEEEcccccEEEEEccccEEEEEEccccccHHEEEcccccccEEEEEEcccccEEEEEccccEEEEEEccccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccccccccccccccccccEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEcccccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccc
MSSIFDLETLldnqyllpktipstenltgtnlilcsrceminsqtlkghqgrvwnvswnpqgtmisscgedknirlwgkesfgnkftakailsdghqrtiretawspcgnfiasasfdattavwdkrsgqfecnatleghenevksvtwskngqflatcsrdksvwvwevgeedeYECAAVINAHIQDvkkvrfhpfdnilasasydDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRigsrlatcsddaTVKIWKeykpgnsagiptpdndsvWKCVCtlsghhgrtiydiswCHLTDLIATACGDDAIRIfkenpeagdsdmvsfdlvhtehrahnqdvncvawnpvvpgmlascsddgdvKLWQIKLENL
MSSIFDLETLLDNQyllpktipstenlTGTNLILCSRCEMINsqtlkghqgrVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINfatlkshtstVWSLAFDRIGSRLATCSDDATVKIWKEYKPgnsagiptpdndsVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
***IFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKEN*****SDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIK****
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLEN*
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
*SSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSIFDLETLLDNQYLLPKTIPSTENLTGTNLILCSRCEMINSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQIKLENL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query377 2.2.26 [Sep-21-2011]
Q17GR9337 Probable cytosolic iron-s N/A N/A 0.872 0.976 0.641 1e-129
Q292E8335 Probable cytosolic iron-s yes N/A 0.877 0.988 0.634 1e-127
B4GDM7335 Probable cytosolic iron-s N/A N/A 0.877 0.988 0.634 1e-127
B4P7Q3335 Probable cytosolic iron-s N/A N/A 0.877 0.988 0.628 1e-126
B4MY77335 Probable cytosolic iron-s N/A N/A 0.877 0.988 0.634 1e-126
B3NQR5335 Probable cytosolic iron-s N/A N/A 0.877 0.988 0.625 1e-126
Q7K1Y4335 Probable cytosolic iron-s yes N/A 0.877 0.988 0.625 1e-126
B3MC74335 Probable cytosolic iron-s N/A N/A 0.864 0.973 0.632 1e-126
B4QFZ8335 Probable cytosolic iron-s N/A N/A 0.877 0.988 0.622 1e-126
B4HRQ6335 Probable cytosolic iron-s N/A N/A 0.877 0.988 0.619 1e-125
>sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 Back     alignment and function desciption
 Score =  461 bits (1185), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 213/332 (64%), Positives = 269/332 (81%), Gaps = 3/332 (0%)

Query: 44  QTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRET 103
           Q L GH+GR W   W+P+G ++++CGEDK IR+W +++   ++ AK +LSDGH RTIR+ 
Sbjct: 8   QCLTGHRGRAWGAGWHPKGNVLATCGEDKTIRIWAEDA-SQRWVAKTVLSDGHSRTIRDV 66

Query: 104 AWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDK 163
           AWSPCG ++ASASFDAT A+WDK+SG+FECNATLEGHENEVKSV+WSK+G  LATCSRDK
Sbjct: 67  AWSPCGQYLASASFDATVAIWDKKSGEFECNATLEGHENEVKSVSWSKSGSLLATCSRDK 126

Query: 164 SVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWI 223
           SVWVWEV +EDEYECAAV+N H QDVKKV +HP ++ILASASYD+T+KL+KED A++DW 
Sbjct: 127 SVWVWEVAQEDEYECAAVLNTHTQDVKKVEWHPHEDILASASYDNTIKLYKEDLADSDWS 186

Query: 224 NFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVC 283
           +F TL SH STVWS++FD  G+RLA+CSDD TVKIW+EYKPGN  G+  PDN  VWKCVC
Sbjct: 187 SFDTLVSHESTVWSISFDGSGNRLASCSDDQTVKIWQEYKPGNEFGVSCPDNTPVWKCVC 246

Query: 284 TLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQ 343
           TL+G+H R++YDISWC  + L+ATACGDD +RIFKE  E       +F++V ++H AH+Q
Sbjct: 247 TLAGYHSRSVYDISWCKQSGLLATACGDDMVRIFKE-VEGSSPHEPTFEMVGSKH-AHSQ 304

Query: 344 DVNCVAWNPVVPGMLASCSDDGDVKLWQIKLE 375
           DVN V WNP V G+L + SDDGDVKLW+ + E
Sbjct: 305 DVNTVEWNPTVVGLLVTTSDDGDVKLWKYEPE 336




Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.
Aedes aegypti (taxid: 7159)
>sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 Back     alignment and function description
>sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 Back     alignment and function description
>sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 Back     alignment and function description
>sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 Back     alignment and function description
>sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 Back     alignment and function description
>sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 Back     alignment and function description
>sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 Back     alignment and function description
>sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 Back     alignment and function description
>sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
322798691 581 hypothetical protein SINV_00781 [Solenop 0.851 0.552 0.692 1e-130
332019251386 Putative cytosolic iron-sulfur protein a 0.856 0.836 0.694 1e-130
307197840334 Protein CIAO1 [Harpegnathos saltator] 0.856 0.967 0.685 1e-129
383862289356 PREDICTED: probable cytosolic iron-sulfu 0.856 0.907 0.688 1e-128
156545541334 PREDICTED: probable cytosolic iron-sulfu 0.856 0.967 0.669 1e-128
380019245334 PREDICTED: probable cytosolic iron-sulfu 0.856 0.967 0.678 1e-127
307187516337 Protein CIAO1 [Camponotus floridanus] 0.859 0.961 0.678 1e-127
157132872337 wd-repeat protein [Aedes aegypti] gi|122 0.872 0.976 0.641 1e-127
357623147336 hypothetical protein KGM_22505 [Danaus p 0.872 0.979 0.662 1e-127
328790407334 PREDICTED: probable cytosolic iron-sulfu 0.856 0.967 0.669 1e-126
>gi|322798691|gb|EFZ20289.1| hypothetical protein SINV_00781 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 267/325 (82%), Gaps = 4/325 (1%)

Query: 44  QTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRET 103
           Q+L GH+GRVW+V W+P+G  ++SCGEDK I +WG E  G K+  K IL++GH RTIRE 
Sbjct: 18  QSLIGHRGRVWSVCWHPKGASLASCGEDKRIIIWGLE--GPKWVTKMILTEGHSRTIREL 75

Query: 104 AWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDK 163
           AWSPCGN+IASASFDAT AVWDK+SGQFECN TLEGHENEVKSV+WS +GQ LATCSRDK
Sbjct: 76  AWSPCGNYIASASFDATIAVWDKKSGQFECNTTLEGHENEVKSVSWSMSGQLLATCSRDK 135

Query: 164 SVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWI 223
           SVWVWEV + DEYECAAVINAH QDVKKVR+HP + ILASASYD+TVK+FKED A++DW 
Sbjct: 136 SVWVWEVND-DEYECAAVINAHTQDVKKVRWHPHEEILASASYDNTVKIFKEDAADSDWS 194

Query: 224 NFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVC 283
             ATL SHTSTVWSL++D+IG+R+ATCSDD TVKIW+EYKPGN  GI TP+N+S+WKC+C
Sbjct: 195 CIATLSSHTSTVWSLSWDKIGNRIATCSDDETVKIWREYKPGNDMGIVTPNNESIWKCIC 254

Query: 284 TLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQ 343
           TLSG+H RTIYDI WC  T L+ TACGDD IRIFKE+ +  D    +F +V +  RAH+Q
Sbjct: 255 TLSGYHTRTIYDIDWCKTTGLLVTACGDDIIRIFKEDSDC-DPHQPNFTMVCSIDRAHDQ 313

Query: 344 DVNCVAWNPVVPGMLASCSDDGDVK 368
           DVNC+ WNP +PG LAS SDD   K
Sbjct: 314 DVNCIQWNPTIPGQLASASDDSLYK 338




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332019251|gb|EGI59760.1| Putative cytosolic iron-sulfur protein assembly protein Ciao1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307197840|gb|EFN78951.1| Protein CIAO1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383862289|ref|XP_003706616.1| PREDICTED: probable cytosolic iron-sulfur protein assembly protein Ciao1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156545541|ref|XP_001604508.1| PREDICTED: probable cytosolic iron-sulfur protein assembly protein Ciao1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380019245|ref|XP_003693521.1| PREDICTED: probable cytosolic iron-sulfur protein assembly protein Ciao1-like [Apis florea] Back     alignment and taxonomy information
>gi|307187516|gb|EFN72567.1| Protein CIAO1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157132872|ref|XP_001662680.1| wd-repeat protein [Aedes aegypti] gi|122106727|sp|Q17GR9.1|CIAO1_AEDAE RecName: Full=Probable cytosolic iron-sulfur protein assembly protein Ciao1 gi|108881643|gb|EAT45868.1| AAEL002912-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|357623147|gb|EHJ74412.1| hypothetical protein KGM_22505 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328790407|ref|XP_395314.4| PREDICTED: probable cytosolic iron-sulfur protein assembly protein Ciao1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
UNIPROTKB|Q17GR9337 Ciao1 "Probable cytosolic iron 0.872 0.976 0.641 4.8e-126
UNIPROTKB|B4GDM7335 Ciao1 "Probable cytosolic iron 0.875 0.985 0.636 2.7e-123
UNIPROTKB|Q292E8335 Ciao1 "Probable cytosolic iron 0.875 0.985 0.636 2.7e-123
UNIPROTKB|B4MY77335 Ciao1 "Probable cytosolic iron 0.875 0.985 0.636 4.4e-123
UNIPROTKB|B3NQR5335 Ciao1 "Probable cytosolic iron 0.875 0.985 0.627 7.2e-123
UNIPROTKB|B4P7Q3335 Ciao1 "Probable cytosolic iron 0.875 0.985 0.630 7.2e-123
FB|FBgn0033972335 Ciao1 "Ciao1" [Drosophila mela 0.875 0.985 0.627 1.2e-122
UNIPROTKB|B3MC74335 Ciao1 "Probable cytosolic iron 0.862 0.970 0.634 1.5e-122
UNIPROTKB|B4QFZ8335 Ciao1 "Probable cytosolic iron 0.875 0.985 0.624 2.4e-122
UNIPROTKB|B0XAF3338 Ciao1 "Probable cytosolic iron 0.864 0.964 0.632 2.4e-122
UNIPROTKB|Q17GR9 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 1238 (440.9 bits), Expect = 4.8e-126, P = 4.8e-126
 Identities = 213/332 (64%), Positives = 269/332 (81%)

Query:    44 QTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRET 103
             Q L GH+GR W   W+P+G ++++CGEDK IR+W +++   ++ AK +LSDGH RTIR+ 
Sbjct:     8 QCLTGHRGRAWGAGWHPKGNVLATCGEDKTIRIWAEDA-SQRWVAKTVLSDGHSRTIRDV 66

Query:   104 AWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDK 163
             AWSPCG ++ASASFDAT A+WDK+SG+FECNATLEGHENEVKSV+WSK+G  LATCSRDK
Sbjct:    67 AWSPCGQYLASASFDATVAIWDKKSGEFECNATLEGHENEVKSVSWSKSGSLLATCSRDK 126

Query:   164 SVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWI 223
             SVWVWEV +EDEYECAAV+N H QDVKKV +HP ++ILASASYD+T+KL+KED A++DW 
Sbjct:   127 SVWVWEVAQEDEYECAAVLNTHTQDVKKVEWHPHEDILASASYDNTIKLYKEDLADSDWS 186

Query:   224 NFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVC 283
             +F TL SH STVWS++FD  G+RLA+CSDD TVKIW+EYKPGN  G+  PDN  VWKCVC
Sbjct:   187 SFDTLVSHESTVWSISFDGSGNRLASCSDDQTVKIWQEYKPGNEFGVSCPDNTPVWKCVC 246

Query:   284 TLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQ 343
             TL+G+H R++YDISWC  + L+ATACGDD +RIFKE  E       +F++V ++H AH+Q
Sbjct:   247 TLAGYHSRSVYDISWCKQSGLLATACGDDMVRIFKE-VEGSSPHEPTFEMVGSKH-AHSQ 304

Query:   344 DVNCVAWNPVVPGMLASCSDDGDVKLWQIKLE 375
             DVN V WNP V G+L + SDDGDVKLW+ + E
Sbjct:   305 DVNTVEWNPTVVGLLVTTSDDGDVKLWKYEPE 336


GO:0016226 "iron-sulfur cluster assembly" evidence=ISS
UNIPROTKB|B4GDM7 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q292E8 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B4MY77 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B3NQR5 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4P7Q3 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0033972 Ciao1 "Ciao1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3MC74 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4QFZ8 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B0XAF3 Ciao1 "Probable cytosolic iron-sulfur protein assembly protein Ciao1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7PS24CIAO1_ANOGANo assigned EC number0.59630.86200.9530yesN/A
Q5M7T1CIAO1_RATNo assigned EC number0.59330.86730.9646yesN/A
B3MC74CIAO1_DROANNo assigned EC number0.63220.86470.9731N/AN/A
Q292E8CIAO1_DROPSNo assigned EC number0.63470.87790.9880yesN/A
Q7K1Y4CIAO1_DROMENo assigned EC number0.62570.87790.9880yesN/A
B5X212CIO1B_SALSANo assigned EC number0.56620.84880.9609N/AN/A
B0XAF3CIAO1_CULQUNo assigned EC number0.62830.86730.9674N/AN/A
Q75C26CIAO1_ASHGONo assigned EC number0.36620.81960.9420yesN/A
B4QFZ8CIAO1_DROSINo assigned EC number0.62270.87790.9880N/AN/A
Q6CMA2CIAO1_KLULANo assigned EC number0.34110.82750.9369yesN/A
B4JW81CIAO1_DROGRNo assigned EC number0.61370.86730.9879N/AN/A
Q99KN2CIAO1_MOUSENo assigned EC number0.59030.86730.9646yesN/A
B4HRQ6CIAO1_DROSENo assigned EC number0.61970.87790.9880N/AN/A
B4LJT7CIAO1_DROVINo assigned EC number0.62080.87000.9909N/AN/A
B4MY77CIAO1_DROWINo assigned EC number0.63470.87790.9880N/AN/A
Q55DA2CIAO1_DICDINo assigned EC number0.38570.84080.9519yesN/A
Q05583CIAO1_YEASTNo assigned EC number0.35880.82220.9393yesN/A
B4GDM7CIAO1_DROPENo assigned EC number0.63470.87790.9880N/AN/A
O76071CIAO1_HUMANNo assigned EC number0.62110.84080.9351yesN/A
B9WHJ2CIAO1_CANDCNo assigned EC number0.34980.85140.8447yesN/A
B5X9P2CIO1A_SALSANo assigned EC number0.56450.84880.9696N/AN/A
B4P7Q3CIAO1_DROYANo assigned EC number0.62870.87790.9880N/AN/A
Q9XW12CIAO1_CAEELNo assigned EC number0.36280.83550.9347yesN/A
A3LVM1CIAO1_PICSTNo assigned EC number0.33060.84080.8781yesN/A
Q6CBI8CIAO1_YARLINo assigned EC number0.39650.83280.9457yesN/A
A7RWD2CIAO1_NEMVENo assigned EC number0.60850.85410.9847N/AN/A
Q28DW0CIAO1_XENTRNo assigned EC number0.58380.83020.9399yesN/A
B3NQR5CIAO1_DROERNo assigned EC number0.62570.87790.9880N/AN/A
B4KTK4CIAO1_DROMONo assigned EC number0.62980.87000.9909N/AN/A
Q17GR9CIAO1_AEDAENo assigned EC number0.64150.87260.9762N/AN/A
Q6P0D9CIAO1_DANRENo assigned EC number0.58120.81960.9363yesN/A
Q32PJ6CIAO1_BOVINNo assigned EC number0.58680.87260.9705yesN/A
Q6FJ73CIAO1_CANGANo assigned EC number0.35530.83020.9287yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-64
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-36
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-32
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-29
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-26
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-23
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-17
smart0032040 smart00320, WD40, WD40 repeats 3e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-07
smart0032040 smart00320, WD40, WD40 repeats 6e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-07
smart0032040 smart00320, WD40, WD40 repeats 1e-06
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 2e-06
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 1e-05
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 2e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 6e-05
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 6e-05
smart0032040 smart00320, WD40, WD40 repeats 2e-04
smart0032040 smart00320, WD40, WD40 repeats 3e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 0.002
PLN00181 793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 0.002
smart0032040 smart00320, WD40, WD40 repeats 0.003
smart0032040 smart00320, WD40, WD40 repeats 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  205 bits (524), Expect = 6e-64
 Identities = 105/330 (31%), Positives = 162/330 (49%), Gaps = 41/330 (12%)

Query: 42  NSQTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIR 101
             +TLKGH G V  V+++P G ++++   D  I++W  E+     T K     GH   +R
Sbjct: 1   LRRTLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLK-----GHTGPVR 55

Query: 102 ETAWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSR 161
           + A S  G ++AS S D T  +WD  +G  EC  TL GH + V SV +S +G+ L++ SR
Sbjct: 56  DVAASADGTYLASGSSDKTIRLWDLETG--ECVRTLTGHTSYVSSVAFSPDGRILSSSSR 113

Query: 162 DKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEAD 221
           DK++ VW+V   +  +C   +  H   V  V F P    +AS+S D T+KL+     +  
Sbjct: 114 DKTIKVWDV---ETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKC- 169

Query: 222 WINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKC 281
               ATL  HT  V S+AF   G +L + S D T+K+W               + S  KC
Sbjct: 170 ---VATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLW---------------DLSTGKC 211

Query: 282 VCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAH 341
           + TL G H   +  +++     L+A+   D  IR++         D+ + + V T    H
Sbjct: 212 LGTLRG-HENGVNSVAFSPDGYLLASGSEDGTIRVW---------DLRTGECVQT-LSGH 260

Query: 342 NQDVNCVAWNPVVPGMLASCSDDGDVKLWQ 371
              V  +AW+P     LAS S DG +++W 
Sbjct: 261 TNSVTSLAWSP-DGKRLASGSADGTIRIWD 289


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 377
KOG0645|consensus312 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0286|consensus343 100.0
KOG0272|consensus459 100.0
KOG0279|consensus315 100.0
KOG0272|consensus459 100.0
KOG0293|consensus519 100.0
KOG0265|consensus338 100.0
KOG0284|consensus464 100.0
KOG0295|consensus406 100.0
KOG0315|consensus311 100.0
KOG0273|consensus524 100.0
KOG0282|consensus503 100.0
KOG0643|consensus327 100.0
KOG0266|consensus456 100.0
KOG0318|consensus603 100.0
KOG0263|consensus707 100.0
KOG0318|consensus603 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0315|consensus311 100.0
KOG0263|consensus707 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0319|consensus 775 100.0
KOG0273|consensus524 100.0
KOG0645|consensus312 100.0
KOG0285|consensus460 100.0
KOG0316|consensus307 100.0
KOG0296|consensus399 100.0
KOG0279|consensus315 100.0
KOG0319|consensus 775 100.0
KOG0291|consensus 893 100.0
KOG0284|consensus464 100.0
KOG0291|consensus 893 100.0
KOG0640|consensus430 100.0
KOG0286|consensus343 100.0
KOG0281|consensus499 100.0
KOG0278|consensus334 100.0
KOG0276|consensus 794 100.0
KOG0277|consensus311 100.0
KOG0292|consensus 1202 100.0
KOG0285|consensus460 100.0
KOG0313|consensus423 100.0
KOG0295|consensus406 100.0
KOG1407|consensus313 100.0
KOG0772|consensus 641 100.0
KOG0292|consensus 1202 100.0
KOG0276|consensus 794 100.0
KOG0266|consensus456 100.0
KOG0306|consensus 888 100.0
KOG1446|consensus311 99.98
KOG0973|consensus 942 99.98
KOG0316|consensus307 99.98
KOG0306|consensus 888 99.97
KOG0264|consensus422 99.97
KOG0300|consensus481 99.97
KOG2096|consensus420 99.97
KOG1332|consensus299 99.97
KOG0313|consensus423 99.97
KOG0281|consensus499 99.97
KOG0265|consensus338 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0296|consensus399 99.97
KOG0275|consensus508 99.97
KOG0277|consensus311 99.97
KOG0274|consensus537 99.97
KOG0289|consensus506 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0268|consensus433 99.97
KOG0283|consensus712 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0288|consensus459 99.96
KOG0647|consensus347 99.96
PTZ00421 493 coronin; Provisional 99.96
KOG0305|consensus484 99.96
KOG0650|consensus733 99.96
KOG0641|consensus350 99.96
KOG0282|consensus503 99.96
KOG0293|consensus519 99.96
PTZ00420 568 coronin; Provisional 99.96
KOG1332|consensus299 99.96
KOG0299|consensus479 99.96
KOG2445|consensus361 99.96
KOG0278|consensus334 99.96
KOG0973|consensus 942 99.96
KOG0283|consensus 712 99.96
KOG0289|consensus506 99.96
KOG0308|consensus 735 99.96
KOG0301|consensus 745 99.96
KOG1063|consensus764 99.95
PTZ00420 568 coronin; Provisional 99.95
KOG1063|consensus 764 99.95
KOG0305|consensus484 99.95
KOG0264|consensus422 99.95
KOG0310|consensus 487 99.95
KOG2106|consensus626 99.95
KOG0275|consensus508 99.95
KOG0274|consensus537 99.95
KOG2445|consensus361 99.95
KOG4328|consensus498 99.95
KOG0310|consensus 487 99.94
KOG0294|consensus362 99.94
KOG1408|consensus 1080 99.94
KOG1036|consensus323 99.94
KOG4283|consensus397 99.94
KOG0641|consensus350 99.94
KOG0640|consensus430 99.94
KOG0321|consensus 720 99.94
KOG1539|consensus 910 99.94
KOG0647|consensus347 99.94
KOG0269|consensus 839 99.94
KOG2055|consensus514 99.94
KOG0288|consensus459 99.93
KOG0639|consensus705 99.93
KOG0772|consensus641 99.93
KOG0300|consensus481 99.93
KOG1446|consensus311 99.93
KOG0294|consensus362 99.93
KOG1407|consensus313 99.93
KOG0308|consensus 735 99.93
KOG0302|consensus440 99.93
KOG0643|consensus327 99.93
KOG0299|consensus479 99.93
KOG1036|consensus323 99.92
KOG0301|consensus 745 99.92
KOG1273|consensus405 99.92
KOG1007|consensus370 99.92
KOG0268|consensus433 99.92
KOG0646|consensus 476 99.92
KOG1334|consensus559 99.92
KOG0302|consensus440 99.91
KOG0269|consensus 839 99.91
KOG4227|consensus 609 99.91
KOG1274|consensus 933 99.91
KOG2919|consensus406 99.91
KOG0267|consensus 825 99.91
KOG0270|consensus463 99.91
KOG0646|consensus476 99.9
KOG2048|consensus 691 99.9
KOG2106|consensus626 99.9
KOG0639|consensus705 99.9
KOG1408|consensus 1080 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG1274|consensus 933 99.89
KOG0267|consensus 825 99.89
KOG1034|consensus385 99.88
KOG2048|consensus 691 99.88
KOG1188|consensus376 99.88
KOG0307|consensus 1049 99.88
KOG0290|consensus364 99.88
KOG0321|consensus 720 99.87
KOG4283|consensus397 99.87
KOG1538|consensus 1081 99.87
KOG1009|consensus434 99.86
KOG0307|consensus 1049 99.86
KOG1273|consensus 405 99.85
KOG1523|consensus361 99.85
KOG4328|consensus498 99.85
KOG1539|consensus 910 99.85
KOG1445|consensus 1012 99.85
KOG0642|consensus577 99.84
KOG1523|consensus361 99.84
KOG2055|consensus514 99.84
KOG4378|consensus 673 99.84
COG2319 466 FOG: WD40 repeat [General function prediction only 99.83
KOG0303|consensus472 99.83
KOG1034|consensus385 99.83
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.83
KOG4378|consensus 673 99.83
KOG2096|consensus 420 99.83
KOG0290|consensus364 99.83
KOG0270|consensus463 99.82
KOG2919|consensus406 99.82
KOG1963|consensus 792 99.82
KOG0644|consensus 1113 99.82
KOG0650|consensus733 99.81
KOG1009|consensus434 99.81
KOG1517|consensus1387 99.81
COG2319466 FOG: WD40 repeat [General function prediction only 99.8
KOG1538|consensus 1081 99.8
KOG1007|consensus370 99.8
KOG1587|consensus555 99.79
PRK11028330 6-phosphogluconolactonase; Provisional 99.78
KOG1587|consensus555 99.78
KOG0303|consensus 472 99.78
KOG0642|consensus577 99.78
KOG1310|consensus 758 99.77
KOG0771|consensus398 99.77
KOG0322|consensus323 99.76
KOG1240|consensus1431 99.75
KOG1188|consensus376 99.74
KOG1524|consensus 737 99.73
PRK11028330 6-phosphogluconolactonase; Provisional 99.72
KOG1517|consensus1387 99.71
KOG0649|consensus325 99.71
KOG1963|consensus 792 99.71
KOG2110|consensus391 99.7
KOG0771|consensus398 99.69
KOG1524|consensus 737 99.68
KOG1445|consensus1012 99.68
PRK01742429 tolB translocation protein TolB; Provisional 99.68
KOG1334|consensus 559 99.68
KOG0322|consensus323 99.67
KOG4227|consensus 609 99.67
KOG1310|consensus 758 99.66
KOG0649|consensus325 99.64
PRK01742429 tolB translocation protein TolB; Provisional 99.64
KOG1409|consensus404 99.58
KOG1272|consensus 545 99.57
KOG2110|consensus391 99.55
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.54
KOG4497|consensus 447 99.53
KOG2139|consensus445 99.52
KOG2111|consensus346 99.51
PRK03629429 tolB translocation protein TolB; Provisional 99.49
KOG2394|consensus 636 99.48
KOG2139|consensus445 99.48
KOG1240|consensus1431 99.48
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.48
KOG2394|consensus 636 99.47
PRK03629429 tolB translocation protein TolB; Provisional 99.44
KOG2111|consensus346 99.44
KOG2321|consensus 703 99.44
PRK02889427 tolB translocation protein TolB; Provisional 99.44
KOG1354|consensus433 99.43
KOG0280|consensus339 99.41
KOG3881|consensus412 99.4
PRK05137435 tolB translocation protein TolB; Provisional 99.39
KOG4497|consensus447 99.39
KOG1354|consensus433 99.38
KOG3881|consensus412 99.38
PRK05137435 tolB translocation protein TolB; Provisional 99.37
KOG0644|consensus 1113 99.37
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.37
PRK04922433 tolB translocation protein TolB; Provisional 99.36
PRK04922433 tolB translocation protein TolB; Provisional 99.36
PRK02889427 tolB translocation protein TolB; Provisional 99.35
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.34
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.33
KOG4547|consensus 541 99.31
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.3
KOG0974|consensus 967 99.3
KOG0974|consensus 967 99.29
KOG1272|consensus 545 99.28
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.26
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.26
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.25
KOG4190|consensus1034 99.24
KOG2321|consensus 703 99.24
KOG1064|consensus2439 99.23
KOG0309|consensus 1081 99.23
KOG2041|consensus 1189 99.17
KOG0280|consensus339 99.16
KOG1064|consensus2439 99.16
PRK00178430 tolB translocation protein TolB; Provisional 99.11
PRK01029428 tolB translocation protein TolB; Provisional 99.1
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.1
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.09
PRK04792448 tolB translocation protein TolB; Provisional 99.09
KOG1409|consensus 404 99.09
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.07
PRK04792448 tolB translocation protein TolB; Provisional 99.06
PRK00178430 tolB translocation protein TolB; Provisional 99.06
KOG2315|consensus 566 99.04
KOG2314|consensus 698 99.01
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.0
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.99
PRK01029428 tolB translocation protein TolB; Provisional 98.97
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.94
KOG4547|consensus 541 98.93
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.89
KOG3914|consensus390 98.88
KOG2041|consensus 1189 98.87
COG4946668 Uncharacterized protein related to the periplasmic 98.86
KOG4532|consensus344 98.86
KOG3914|consensus390 98.85
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.79
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.79
KOG0309|consensus 1081 98.77
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.77
KOG2315|consensus566 98.74
KOG4714|consensus319 98.7
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.68
KOG4714|consensus319 98.67
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.67
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.65
KOG0882|consensus 558 98.58
KOG1912|consensus 1062 98.55
KOG1920|consensus 1265 98.54
KOG4532|consensus344 98.54
COG4946668 Uncharacterized protein related to the periplasmic 98.51
KOG1008|consensus 783 98.51
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.51
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.48
PRK04043419 tolB translocation protein TolB; Provisional 98.46
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.44
KOG2695|consensus425 98.41
KOG2066|consensus 846 98.4
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.4
KOG2695|consensus425 98.37
KOG4190|consensus1034 98.37
KOG2314|consensus 698 98.36
KOG0882|consensus 558 98.34
KOG1832|consensus 1516 98.27
PRK04043419 tolB translocation protein TolB; Provisional 98.24
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.23
KOG3617|consensus 1416 98.2
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.19
KOG1912|consensus 1062 98.18
KOG1008|consensus 783 98.17
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.12
KOG2066|consensus 846 98.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.08
KOG1920|consensus 1265 98.07
KOG2114|consensus 933 98.01
KOG2114|consensus 933 97.95
KOG1275|consensus 1118 97.94
KOG1645|consensus463 97.89
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.87
KOG1275|consensus 1118 97.84
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.84
KOG1645|consensus463 97.81
KOG3617|consensus 1416 97.8
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.79
KOG3621|consensus 726 97.69
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.69
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.66
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.6
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.57
KOG3621|consensus 726 97.43
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.43
KOG1832|consensus 1516 97.41
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.38
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.32
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.26
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.26
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.25
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.23
KOG4640|consensus 665 97.18
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.07
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.06
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.02
KOG4640|consensus 665 96.96
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.94
PRK02888635 nitrous-oxide reductase; Validated 96.69
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.69
PRK13616591 lipoprotein LpqB; Provisional 96.69
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.63
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.61
KOG2079|consensus 1206 96.6
KOG4441|consensus571 96.41
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.32
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.28
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.23
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.23
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.21
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.19
PRK13616591 lipoprotein LpqB; Provisional 96.18
PRK02888 635 nitrous-oxide reductase; Validated 96.12
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.07
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.05
PHA02713557 hypothetical protein; Provisional 96.05
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.92
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.87
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.78
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.51
COG3391381 Uncharacterized conserved protein [Function unknow 95.44
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.42
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.25
PHA02713557 hypothetical protein; Provisional 95.24
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.12
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.12
KOG2079|consensus 1206 95.07
KOG4441|consensus571 95.03
KOG2444|consensus238 94.89
KOG4649|consensus354 94.89
KOG2444|consensus238 94.87
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.81
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.48
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.46
KOG2395|consensus644 94.27
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 94.26
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.26
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.13
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.01
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.87
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.64
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 93.54
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.46
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 93.46
KOG4649|consensus354 93.4
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.25
PHA03098534 kelch-like protein; Provisional 92.77
COG5276370 Uncharacterized conserved protein [Function unknow 92.67
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.63
KOG3630|consensus 1405 92.22
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 91.4
KOG1916|consensus 1283 91.33
COG3386307 Gluconolactonase [Carbohydrate transport and metab 91.22
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.92
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.77
KOG2377|consensus 657 90.74
KOG2395|consensus644 90.7
PHA02790480 Kelch-like protein; Provisional 90.66
KOG1916|consensus 1283 90.08
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 89.01
KOG2377|consensus 657 87.94
KOG3630|consensus 1405 87.89
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 87.35
KOG1897|consensus 1096 86.45
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 86.11
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 85.67
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 85.56
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 85.36
PRK13684334 Ycf48-like protein; Provisional 84.87
KOG2247|consensus 615 84.34
COG3490366 Uncharacterized protein conserved in bacteria [Fun 83.91
COG3204316 Uncharacterized protein conserved in bacteria [Fun 83.82
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 83.73
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 83.67
COG4590 733 ABC-type uncharacterized transport system, permeas 83.57
KOG4499|consensus310 83.55
COG3391381 Uncharacterized conserved protein [Function unknow 83.1
PHA03098534 kelch-like protein; Provisional 82.33
PRK13684334 Ycf48-like protein; Provisional 82.03
KOG4460|consensus 741 81.69
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 81.66
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 81.24
KOG1900|consensus 1311 80.46
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 80.02
>KOG0645|consensus Back     alignment and domain information
Probab=100.00  E-value=6.5e-55  Score=354.44  Aligned_cols=306  Identities=54%  Similarity=1.055  Sum_probs=274.0

Q ss_pred             ccccccccccCCEEEEEECCC-CCEEEEEeCCCcEEEeecccCCCcccceeeeeccCcCceeEEEECCCCCEEEEEECCC
Q psy18091         41 INSQTLKGHQGRVWNVSWNPQ-GTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDA  119 (377)
Q Consensus        41 ~~~~~l~~h~~~V~~v~~~~~-g~~l~s~s~D~~v~~W~~~~~~~~~~~~~~~~~~h~~~V~~~~~~~~~~~l~s~s~d~  119 (377)
                      ...+.++||+++|+.++|+|- |..|||||.|+.||+|+... +..+..+.++-++|+..|+++||+|.|++|+++|.|.
T Consensus         5 ~~~~~~~gh~~r~W~~awhp~~g~ilAscg~Dk~vriw~~~~-~~s~~ck~vld~~hkrsVRsvAwsp~g~~La~aSFD~   83 (312)
T KOG0645|consen    5 ILEQKLSGHKDRVWSVAWHPGKGVILASCGTDKAVRIWSTSS-GDSWTCKTVLDDGHKRSVRSVAWSPHGRYLASASFDA   83 (312)
T ss_pred             eeEEeecCCCCcEEEEEeccCCceEEEeecCCceEEEEecCC-CCcEEEEEeccccchheeeeeeecCCCcEEEEeeccc
Confidence            345678999999999999997 88999999999999999875 4567777777789999999999999999999999999


Q ss_pred             cEEEEeCCCCceEEeEEecCccCCEEEEEEcCCCCEEEEEECCCcEEEEEcCCCCceeEEEEeeccccceeEEEEeeCCc
Q psy18091        120 TTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDN  199 (377)
Q Consensus       120 ~i~iwd~~~~~~~~~~~~~~h~~~v~~l~~~~~~~~l~s~~~dg~v~~wd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~  199 (377)
                      ++.||.-..+++++...++||.++|.+++|+++|+||+++++|++|++|.+...+++.|...++.|.+.|..+.|||...
T Consensus        84 t~~Iw~k~~~efecv~~lEGHEnEVK~Vaws~sG~~LATCSRDKSVWiWe~deddEfec~aVL~~HtqDVK~V~WHPt~d  163 (312)
T KOG0645|consen   84 TVVIWKKEDGEFECVATLEGHENEVKCVAWSASGNYLATCSRDKSVWIWEIDEDDEFECIAVLQEHTQDVKHVIWHPTED  163 (312)
T ss_pred             eEEEeecCCCceeEEeeeeccccceeEEEEcCCCCEEEEeeCCCeEEEEEecCCCcEEEEeeeccccccccEEEEcCCcc
Confidence            99999988999999999999999999999999999999999999999999998899999999999999999999999999


Q ss_pred             EEEEeeCCCcEEEEecCcccccceeeeecccCCcceEEEEEcCCCCeEEEeeCCCcEEEEeeeCCCCCCCCCCCCCCCcE
Q psy18091        200 ILASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVW  279 (377)
Q Consensus       200 ~l~s~s~dg~i~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~s~s~D~~i~iw~~~~~~~~~~~~~~~~~~~~  279 (377)
                      +|++++-|.+|++|.... ...|...+++.+|+..|++++|++.|.+|++++.|++++||..+                 
T Consensus       164 lL~S~SYDnTIk~~~~~~-dddW~c~~tl~g~~~TVW~~~F~~~G~rl~s~sdD~tv~Iw~~~-----------------  225 (312)
T KOG0645|consen  164 LLFSCSYDNTIKVYRDED-DDDWECVQTLDGHENTVWSLAFDNIGSRLVSCSDDGTVSIWRLY-----------------  225 (312)
T ss_pred             eeEEeccCCeEEEEeecC-CCCeeEEEEecCccceEEEEEecCCCceEEEecCCcceEeeeec-----------------
Confidence            999999999999998765 55788889999999999999999999999999999999999753                 


Q ss_pred             EEEEeecCCCCcceeEEEecccCCEEEEEeCCCcEEEEEeCCCCCCCcceeeeeeeccccceecceeEEEecCCCCceEE
Q psy18091        280 KCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLA  359 (377)
Q Consensus       280 ~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~v~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~la  359 (377)
                         ..+++-|..+++.+.|.  +..|+++++|++|++|.......+   ..+.++.....+|...|++|.|+|..+..|+
T Consensus       226 ---~~~~~~~sr~~Y~v~W~--~~~IaS~ggD~~i~lf~~s~~~d~---p~~~l~~~~~~aHe~dVNsV~w~p~~~~~L~  297 (312)
T KOG0645|consen  226 ---TDLSGMHSRALYDVPWD--NGVIASGGGDDAIRLFKESDSPDE---PSWNLLAKKEGAHEVDVNSVQWNPKVSNRLA  297 (312)
T ss_pred             ---cCcchhcccceEeeeec--ccceEeccCCCEEEEEEecCCCCC---chHHHHHhhhcccccccceEEEcCCCCCcee
Confidence               22334466799999998  789999999999999987643222   2344455566789999999999996677899


Q ss_pred             EeeCCCcEEEEecc
Q psy18091        360 SCSDDGDVKLWQIK  373 (377)
Q Consensus       360 S~s~Dg~i~iWd~~  373 (377)
                      |||+||.|++|.+.
T Consensus       298 s~~DDG~v~~W~l~  311 (312)
T KOG0645|consen  298 SGGDDGIVNFWELE  311 (312)
T ss_pred             ecCCCceEEEEEec
Confidence            99999999999975



>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-120
3fm0_A 345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-08
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 2e-48
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 5e-34
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 5e-19
1vyh_C 410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-10
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-18
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 7e-09
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-18
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 6e-09
2h9l_A329 Wdr5delta23 Length = 329 1e-18
2h9l_A329 Wdr5delta23 Length = 329 7e-09
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-18
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-09
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-18
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 7e-09
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-18
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 7e-09
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-18
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 7e-09
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-18
2g99_A308 Structural Basis For The Specific Recognition Of Me 8e-09
2gnq_A336 Structure Of Wdr5 Length = 336 1e-18
2gnq_A336 Structure Of Wdr5 Length = 336 7e-09
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-18
2g9a_A311 Structural Basis For The Specific Recognition Of Me 8e-09
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-18
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 7e-09
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-18
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 8e-09
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-18
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 9e-09
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-18
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 7e-09
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-18
2cnx_A 315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 3e-04
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 4e-18
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-17
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 7e-09
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 2e-15
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 1e-06
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 7e-15
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 7e-14
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-13
3zey_7318 High-resolution Cryo-electron Microscopy Structure 4e-13
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 2e-12
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 6e-08
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 2e-12
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 6e-08
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 4e-12
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 6e-08
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-12
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-08
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-12
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-08
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 5e-12
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-08
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 7e-12
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 4e-07
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 7e-12
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 2e-07
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 7e-12
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-07
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 1e-11
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 7e-04
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 3e-11
3ewe_A349 Crystal Structure Of The Nup85SEH1 COMPLEX Length = 3e-11
3f3f_A351 Crystal Structure Of The Nucleoporin Pair Nup85-Seh 3e-11
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 4e-11
3f3p_A351 Crystal Structure Of The Nucleoporin Pair Nup85-Seh 6e-11
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 6e-11
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 7e-11
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 9e-11
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 9e-11
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 1e-06
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 9e-11
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-10
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 1e-10
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 1e-10
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 1e-10
2pm6_B 297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 1e-06
3jrp_A379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 1e-10
3jrp_A379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 2e-10
3jrp_A 379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 1e-06
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-10
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 3e-08
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 2e-10
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 3e-10
2pm9_B 297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 8e-07
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 4e-10
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 5e-10
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 5e-07
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 8e-10
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 2e-04
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 2e-09
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 4e-09
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 4e-09
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 4e-04
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 2e-08
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 5e-07
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-08
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 5e-07
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 3e-08
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 3e-08
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 5e-07
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 4e-08
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 5e-08
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 5e-08
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-07
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 2e-07
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 2e-07
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 5e-07
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 2e-07
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 1e-06
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 2e-07
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 3e-07
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 2e-07
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 3e-07
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-07
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-07
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 4e-07
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-06
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 3e-06
1nr0_A 611 Two Seven-Bladed Beta-Propeller Domains Revealed By 1e-06
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 2e-05
1k8k_C372 Crystal Structure Of Arp23 COMPLEX Length = 372 2e-05
3dxk_C372 Structure Of Bos Taurus Arp23 COMPLEX WITH BOUND IN 2e-05
3zwl_B369 Structure Of Eukaryotic Translation Initiation Fact 8e-05
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 4e-04
4e5z_B436 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 5e-04
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 5e-04
1r5m_A425 Crystal Structure Of The C-Terminal Wd40 Domain Of 5e-04
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure

Iteration: 1

Score = 429 bits (1102), Expect = e-120, Method: Compositional matrix adjust. Identities = 200/322 (62%), Positives = 249/322 (77%), Gaps = 5/322 (1%) Query: 52 RVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNF 111 R W ++WNP GT+++SCG D+ IR+WG E G+ + K++LS+GHQRT+R+ AWSPCGN+ Sbjct: 18 RCWFLAWNPAGTLLASCGGDRRIRIWGTE--GDSWICKSVLSEGHQRTVRKVAWSPCGNY 75 Query: 112 IASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVG 171 +ASASFDATT +W K FEC TLEGHENEVKSV W+ +G LATCSRDKSVWVWEV Sbjct: 76 LASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVD 135 Query: 172 EEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWINFATLKSH 231 EEDEYEC +V+N+H QDVK V +HP +LASASYDDTVKL++E+ E DW+ ATL+ H Sbjct: 136 EEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREE--EDDWVCCATLEGH 193 Query: 232 TSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSGHHGR 291 STVWSLAFD G RLA+CSDD TV+IW++Y PGN G+ +D WKC+CTLSG H R Sbjct: 194 ESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSR 253 Query: 292 TIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWN 351 TIYDI+WC LT +ATACGDDAIR+F+E+P + D +F L H+AH+QDVNCVAWN Sbjct: 254 TIYDIAWCQLTGALATACGDDAIRVFQEDPNS-DPQQPTFSLTAHLHQAHSQDVNCVAWN 312 Query: 352 PVVPGMLASCSDDGDVKLWQIK 373 P PG+LASCSDDG+V W+ + Sbjct: 313 PKEPGLLASCSDDGEVAFWKYQ 334
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3EWE|A Chain A, Crystal Structure Of The Nup85SEH1 COMPLEX Length = 349 Back     alignment and structure
>pdb|3F3F|A Chain A, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1, Space Group P21 Length = 351 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3F3P|A Chain A, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1, Space Group P21212 Length = 351 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|1K8K|C Chain C, Crystal Structure Of Arp23 COMPLEX Length = 372 Back     alignment and structure
>pdb|3DXK|C Chain C, Structure Of Bos Taurus Arp23 COMPLEX WITH BOUND INHIBITOR Ck0944636 Length = 372 Back     alignment and structure
>pdb|3ZWL|B Chain B, Structure Of Eukaryotic Translation Initiation Factor Eif3i Complex With Eif3b C-Terminus (655-700) Length = 369 Back     alignment and structure
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure
>pdb|4E5Z|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 436 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure
>pdb|1R5M|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Sif2 Length = 425 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.98
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.93
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.93
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.93
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.92
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.91
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.91
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.91
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.89
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.89
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.89
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.88
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.88
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.87
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.87
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.87
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.87
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.86
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.86
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.86
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.86
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.85
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.83
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.83
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.83
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.82
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.81
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.8
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.8
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.79
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.77
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.77
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.76
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.75
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.7
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.69
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.69
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.68
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.67
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.66
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.66
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.64
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.63
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.63
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.62
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.62
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.62
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.59
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.59
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.58
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.58
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.58
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.57
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.57
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.57
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.54
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.52
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.51
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.49
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.48
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.46
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.44
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.42
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.42
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.41
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.37
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.37
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.32
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.3
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.27
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.27
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.27
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.26
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.24
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.23
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.23
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.21
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.18
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.18
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.17
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.14
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.13
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.11
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.1
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.06
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.04
2qe8_A343 Uncharacterized protein; structural genomics, join 99.04
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.02
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.94
2qe8_A343 Uncharacterized protein; structural genomics, join 98.82
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.76
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.73
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.61
2ece_A462 462AA long hypothetical selenium-binding protein; 98.58
2ece_A462 462AA long hypothetical selenium-binding protein; 98.58
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.58
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.49
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.45
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.45
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.43
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.38
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.38
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.38
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.37
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.34
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.23
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.18
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.16
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.13
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.12
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.12
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.07
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.06
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.05
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.04
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.03
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.94
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.91
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.91
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.89
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.88
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.86
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.85
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.85
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 97.79
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.77
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.77
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.77
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.74
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.71
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.71
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.67
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.66
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.64
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.6
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.55
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.49
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.45
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.41
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.28
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.22
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.15
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.14
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.06
3v65_B386 Low-density lipoprotein receptor-related protein; 96.96
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.9
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.89
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.89
3kya_A496 Putative phosphatase; structural genomics, joint c 96.85
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.82
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.81
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.73
3kya_A496 Putative phosphatase; structural genomics, joint c 96.72
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.68
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.49
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.47
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.46
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.44
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.33
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.32
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.16
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.08
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 95.97
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.96
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 95.92
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.7
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.54
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.34
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 95.31
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 94.96
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 94.91
3v65_B386 Low-density lipoprotein receptor-related protein; 94.81
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.37
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 93.94
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 93.9
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 93.87
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 93.8
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.79
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 93.76
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 93.73
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 93.49
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.97
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 92.9
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 92.85
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 92.64
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 92.21
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.15
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 91.88
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 91.62
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 91.52
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 89.76
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 88.98
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 88.75
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 88.41
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 88.28
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 88.24
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 87.14
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 85.89
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 84.87
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 83.49
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.5e-53  Score=387.77  Aligned_cols=329  Identities=60%  Similarity=1.166  Sum_probs=275.5

Q ss_pred             ccccccccC-CEEEEEECCCCCEEEEEeCCCcEEEeecccCCCcccceeeeeccCcCceeEEEECCCCCEEEEEECCCcE
Q psy18091         43 SQTLKGHQG-RVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATT  121 (377)
Q Consensus        43 ~~~l~~h~~-~V~~v~~~~~g~~l~s~s~D~~v~~W~~~~~~~~~~~~~~~~~~h~~~V~~~~~~~~~~~l~s~s~d~~i  121 (377)
                      ..++.+|.+ .|++++|+|+|++||+|+.|++|++|+.+.  ...........+|...|.+++|+|++++|++|+.|+.+
T Consensus         8 ~~~~~~h~~~~v~~l~~sp~g~~las~~~D~~i~iw~~~~--~~~~~~~~~~~~h~~~v~~~~~sp~g~~l~s~s~D~~v   85 (345)
T 3fm0_A            8 LGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEG--DSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATT   85 (345)
T ss_dssp             EEEECCSTTSCEEEEEECTTSSCEEEEETTSCEEEEEEET--TEEEEEEEECSSCSSCEEEEEECTTSSEEEEEETTSCE
T ss_pred             eeeecCCCCCcEEEEEECCCCCEEEEEcCCCeEEEEEcCC--CcceeeeeeccccCCcEEEEEECCCCCEEEEEECCCcE
Confidence            457889987 999999999999999999999999999873  22222333446899999999999999999999999999


Q ss_pred             EEEeCCCCceEEeEEecCccCCEEEEEEcCCCCEEEEEECCCcEEEEEcCCCCceeEEEEeeccccceeEEEEeeCCcEE
Q psy18091        122 AVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNIL  201 (377)
Q Consensus       122 ~iwd~~~~~~~~~~~~~~h~~~v~~l~~~~~~~~l~s~~~dg~v~~wd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l  201 (377)
                      ++||...+...+...+.+|..+|.+++|+|++++|++|+.|++|++||++......+...+..|...|.+++|+|++++|
T Consensus        86 ~iw~~~~~~~~~~~~~~~h~~~v~~v~~sp~~~~l~s~s~D~~v~iwd~~~~~~~~~~~~~~~h~~~v~~~~~~p~~~~l  165 (345)
T 3fm0_A           86 CIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELL  165 (345)
T ss_dssp             EEEEECCC-EEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEEECTTSCEEEEEEECCCCSCEEEEEECSSSSCE
T ss_pred             EEEEccCCCeEEEEEccCCCCCceEEEEeCCCCEEEEEECCCeEEEEECCCCCCeEEEEEecCcCCCeEEEEECCCCCEE
Confidence            99999888777778899999999999999999999999999999999998877666777788999999999999999999


Q ss_pred             EEeeCCCcEEEEecCcccccceeeeecccCCcceEEEEEcCCCCeEEEeeCCCcEEEEeeeCCCCCCCCCCCCCCCcEEE
Q psy18091        202 ASASYDDTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKC  281 (377)
Q Consensus       202 ~s~s~dg~i~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~s~s~D~~i~iw~~~~~~~~~~~~~~~~~~~~~~  281 (377)
                      ++|+.|+.|++|+.+...  +.....+.+|...|++++|+|+|.+|++++.|++|++|+...++....+........+.|
T Consensus       166 ~s~s~d~~i~~w~~~~~~--~~~~~~~~~h~~~v~~l~~sp~g~~l~s~s~D~~v~iW~~~~~~~~~~~~~~~~~~~~~~  243 (345)
T 3fm0_A          166 ASASYDDTVKLYREEEDD--WVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKC  243 (345)
T ss_dssp             EEEETTSCEEEEEEETTE--EEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEEEECTTCTTCCCCC---CEEEE
T ss_pred             EEEeCCCcEEEEEecCCC--EEEEEEecCCCCceEEEEECCCCCEEEEEeCCCeEEEeccccCCCCccceeeccCCccce
Confidence            999999999999986543  233467789999999999999999999999999999999876655544443334556788


Q ss_pred             EEeecCCCCcceeEEEecccCCEEEEEeCCCcEEEEEeCCCCCCCcceeeeeeeccccceecceeEEEecCCCCceEEEe
Q psy18091        282 VCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASC  361 (377)
Q Consensus       282 ~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~v~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~laS~  361 (377)
                      ..++.+.|...|++++|++.+..|++++.|+.+++|+........ ...+.+......+|...|++|+|+|.++.+||||
T Consensus       244 ~~~~~~~h~~~v~~v~~~~~~~~l~s~~~d~~i~vw~~~~~~~~~-~~~~~~~~~~~~~h~~~V~~v~~~p~~~~~laS~  322 (345)
T 3fm0_A          244 ICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQ-QPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASC  322 (345)
T ss_dssp             EEEECSSCSSCEEEEEECTTTCCEEEEETTSCEEEEEECTTSCTT-SCCEEEEEEETTSSSSCEEEEEECSSSTTEEEEE
T ss_pred             eEEecCCCCCcEEEEEEecCCCEEEEEeCCCeEEEEEeCCCCCcc-eeeEEEEeeecccccCcEeEeEEeCCCceEEEEc
Confidence            889988778899999999999999999999999999976543211 1122222333468999999999999766689999


Q ss_pred             eCCCcEEEEecccCC
Q psy18091        362 SDDGDVKLWQIKLEN  376 (377)
Q Consensus       362 s~Dg~i~iWd~~~~~  376 (377)
                      |.||+|+||+++.++
T Consensus       323 s~Dg~v~~W~~~~~~  337 (345)
T 3fm0_A          323 SDDGEVAFWKYQRPE  337 (345)
T ss_dssp             ETTSCEEEEEECC--
T ss_pred             CCCCcEEEEEecCCC
Confidence            999999999998764



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 377
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-29
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-21
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-21
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-26
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-19
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-26
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-18
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-20
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-19
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-17
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-08
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-15
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-10
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-15
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-09
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-15
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-07
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-14
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-14
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-12
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-11
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-11
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-13
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-08
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-13
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-12
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-12
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-11
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-11
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-10
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 4e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 5e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 1e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  112 bits (279), Expect = 7e-29
 Identities = 79/333 (23%), Positives = 140/333 (42%), Gaps = 31/333 (9%)

Query: 44  QTLKGHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRET 103
             L GH+  V  V ++P  +++ S  ED  I++W  E+   + T K     GH  ++++ 
Sbjct: 11  YALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLK-----GHTDSVQDI 65

Query: 104 AWSPCGNFIASASFDATTAVWDKRSGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDK 163
           ++   G  +AS S D T  +WD +   FEC  T+ GH++ V SV+   NG  + + SRDK
Sbjct: 66  SFDHSGKLLASCSADMTIKLWDFQ--GFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDK 123

Query: 164 SVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYDDTVKLFKEDKAEADWI 223
           ++ +WEV       C      H + V+ VR +    ++AS S D TV+++          
Sbjct: 124 TIKMWEV---QTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVA----TKE 176

Query: 224 NFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIW-----KEYKPGNSAGIPTPDNDSV 278
             A L+ H   V  +++    S  +      +              G+        + S 
Sbjct: 177 CKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVST 236

Query: 279 WKCVCTLSGHHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEH 338
             C+ TL GH    +  + +      I +   D  +R++         D  +   + T  
Sbjct: 237 GMCLMTLVGHDN-WVRGVLFHSGGKFILSCADDKTLRVW---------DYKNKRCMKT-L 285

Query: 339 RAHNQDVNCVAWNPVVPGMLASCSDDGDVKLWQ 371
            AH   V  + ++   P  + + S D  VK+W+
Sbjct: 286 NAHEHFVTSLDFHKTAP-YVVTGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.86
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.83
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.83
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.83
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.77
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.76
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.76
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.72
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.67
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.58
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.51
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.47
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.46
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.46
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.26
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.24
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.11
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.11
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.06
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.99
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.95
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.92
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.91
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.9
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.75
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.75
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.66
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.66
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.6
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.59
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.45
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.45
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.36
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.11
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.79
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.74
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.87
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.64
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.62
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.3
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.83
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.35
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 89.13
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 88.92
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 86.74
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 86.12
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 84.7
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 83.99
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 80.91
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=6e-43  Score=315.62  Aligned_cols=288  Identities=15%  Similarity=0.243  Sum_probs=239.5

Q ss_pred             cccCCEEEEEECCCCCEEEEEeCCCcEEEeecccCCCcccceeeeeccCcCceeEEEECCCCCEEEEEECCCcEEEEeCC
Q psy18091         48 GHQGRVWNVSWNPQGTMISSCGEDKNIRLWGKESFGNKFTAKAILSDGHQRTIRETAWSPCGNFIASASFDATTAVWDKR  127 (377)
Q Consensus        48 ~h~~~V~~v~~~~~g~~l~s~s~D~~v~~W~~~~~~~~~~~~~~~~~~h~~~V~~~~~~~~~~~l~s~s~d~~i~iwd~~  127 (377)
                      +|...|++++|+|+|++|+||+ ||.|++||+...............+|...|.+++|+|++++|++|+.|+.|++||+.
T Consensus        49 ~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~  127 (337)
T d1gxra_          49 NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLA  127 (337)
T ss_dssp             CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECC
T ss_pred             CCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeeccccccccccc
Confidence            6999999999999999999998 799999998754333333333445789999999999999999999999999999988


Q ss_pred             CCceEEeEEecCccCCEEEEEEcCCCCEEEEEECCCcEEEEEcCCCCceeEEEEeeccccceeEEEEeeCCcEEEEeeCC
Q psy18091        128 SGQFECNATLEGHENEVKSVTWSKNGQFLATCSRDKSVWVWEVGEEDEYECAAVINAHIQDVKKVRFHPFDNILASASYD  207 (377)
Q Consensus       128 ~~~~~~~~~~~~h~~~v~~l~~~~~~~~l~s~~~dg~v~~wd~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d  207 (377)
                      .........+..|...+.+++|+|++.++++++.|+.+++|++.+..   +......|...+.+++|++++..+++++.|
T Consensus       128 ~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~---~~~~~~~~~~~v~~l~~s~~~~~~~~~~~d  204 (337)
T d1gxra_         128 APTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQT---LVRQFQGHTDGASCIDISNDGTKLWTGGLD  204 (337)
T ss_dssp             CC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTE---EEEEECCCSSCEEEEEECTTSSEEEEEETT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccc---cccccccccccccccccccccccccccccc
Confidence            66656667788899999999999999999999999999999998763   344567788999999999999999999999


Q ss_pred             CcEEEEecCcccccceeeeecccCCcceEEEEEcCCCCeEEEeeCCCcEEEEeeeCCCCCCCCCCCCCCCcEEEEEeecC
Q psy18091        208 DTVKLFKEDKAEADWINFATLKSHTSTVWSLAFDRIGSRLATCSDDATVKIWKEYKPGNSAGIPTPDNDSVWKCVCTLSG  287 (377)
Q Consensus       208 g~i~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~s~s~D~~i~iw~~~~~~~~~~~~~~~~~~~~~~~~~~~~  287 (377)
                      +.+++|+++..+.    + ....|...|.+++|+|++.+|++++.|+.+++|+......                .....
T Consensus       205 ~~v~i~d~~~~~~----~-~~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~----------------~~~~~  263 (337)
T d1gxra_         205 NTVRSWDLREGRQ----L-QQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDK----------------YQLHL  263 (337)
T ss_dssp             SEEEEEETTTTEE----E-EEEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCE----------------EEECC
T ss_pred             cccccccccccee----e-cccccccceEEEEEcccccccceecccccccccccccccc----------------ccccc
Confidence            9999999876542    1 2235788999999999999999999999999999643211                12223


Q ss_pred             CCCcceeEEEecccCCEEEEEeCCCcEEEEEeCCCCCCCcceeeeeeeccccceecceeEEEecCCCCceEEEeeCCCcE
Q psy18091        288 HHGRTIYDISWCHLTDLIATACGDDAIRIFKENPEAGDSDMVSFDLVHTEHRAHNQDVNCVAWNPVVPGMLASCSDDGDV  367 (377)
Q Consensus       288 ~~~~~v~~~~~~~~~~~l~~~~~d~~i~v~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~laS~s~Dg~i  367 (377)
                       +...|..+.|+|++++|++++.|+.+++|+....+         .+..  ..|..+|++++|+|+ +.+|+|||.||+|
T Consensus       264 -~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~---------~~~~--~~~~~~v~~~~~s~d-~~~l~t~s~D~~I  330 (337)
T d1gxra_         264 -HESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGA---------SIFQ--SKESSSVLSCDISVD-DKYIVTGSGDKKA  330 (337)
T ss_dssp             -CSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCC---------EEEE--EECSSCEEEEEECTT-SCEEEEEETTSCE
T ss_pred             -cccccceEEECCCCCEEEEEeCCCeEEEEECCCCC---------EEEE--ccCCCCEEEEEEeCC-CCEEEEEeCCCeE
Confidence             45689999999999999999999999999875443         1111  247789999999995 6789999999999


Q ss_pred             EEEecc
Q psy18091        368 KLWQIK  373 (377)
Q Consensus       368 ~iWd~~  373 (377)
                      +|||+.
T Consensus       331 ~vWdl~  336 (337)
T d1gxra_         331 TVYEVI  336 (337)
T ss_dssp             EEEEEE
T ss_pred             EEEEEE
Confidence            999974



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure