Diaphorina citri psyllid: psy18100


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MLATILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTANVA
cHHHHHHHHcccccccccccccccccccCEEEEEcccccccccccccHHHHHHHHHccccEEEEEEEEcccccccc
*LATIL*LNM*****************CNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLATILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTANVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor 45 Splice factor that binds to the single stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites. Promotes the utilization of a cryptic splice site created by the beta-110 mutation in the HBB gene. The resulting frameshift leads to sickle cell anemia.confidentQ96I25
DNA-damage-repair/toleration protein DRT111, chloroplastic Seems to be involved in the resistance to UV light and chemical DNA-damaging agents.confidentP42698
Splicing factor 45 Splice factor that binds to the single stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites.confidentQ8JZX4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UE2, chain A
Confidence level:very confident
Coverage over the Query: 25-71
View the alignment between query and template
View the model in PyMOL
Template: 3UE2, chain A
Confidence level:confident
Coverage over the Query: 3-36
View the alignment between query and template
View the model in PyMOL