Psyllid ID: psy18100


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70------
MLATILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTANVA
cHHHHHHHHcccccccccccccccccccEEEEEEcccccccccccccHHHHHHHHHccccEEEEEEEEcccccccc
cHHHHHHHHcccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHccccccEEEEEEEEcccccccc
MLATILdlnmvgpgevdsdlepevkeecntkygenmvgpgevdsdlepevkdecnTKYGEVVRVIIHelpttanva
mlatildlnmvgpgevdsdlepEVKEECntkygenmvgpgevdsdlepEVKDECNTKYGEVVRVIIHelpttanva
MLATILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTANVA
*****************************************************CNTKYGEVVRVIIHEL*******
*LATIL*LNM*****************CNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHE*PT*****
MLATILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTANVA
MLATILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLATILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTANVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query76 2.2.26 [Sep-21-2011]
P42698387 DNA-damage-repair/tolerat yes N/A 0.460 0.090 0.611 0.0002
Q8JZX4405 Splicing factor 45 OS=Mus yes N/A 0.473 0.088 0.594 0.0003
Q96I25401 Splicing factor 45 OS=Hom yes N/A 0.473 0.089 0.594 0.0003
Q6IQE0516 Poly(U)-binding-splicing no N/A 0.434 0.063 0.617 0.0007
>sp|P42698|DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana GN=DRT111 PE=2 SV=2 Back     alignment and function desciption
 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 34  ENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHEL 69
            NMVGPG+VD +LE EV  EC  KYG V RV+I E+
Sbjct: 288 RNMVGPGQVDDELEDEVGGECG-KYGTVTRVLIFEI 322




Seems to be involved in the resistance to UV light and chemical DNA-damaging agents.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8JZX4|SPF45_MOUSE Splicing factor 45 OS=Mus musculus GN=Rbm17 PE=1 SV=1 Back     alignment and function description
>sp|Q96I25|SPF45_HUMAN Splicing factor 45 OS=Homo sapiens GN=RBM17 PE=1 SV=1 Back     alignment and function description
>sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
383858690 382 PREDICTED: splicing factor 45-like [Mega 0.526 0.104 0.8 9e-11
332022266 383 Splicing factor 45 [Acromyrmex echinatio 0.473 0.093 0.861 1e-10
312382254 178 hypothetical protein AND_05136 [Anophele 0.763 0.325 0.586 1e-10
322800820 242 hypothetical protein SINV_12429 [Solenop 0.473 0.148 0.861 2e-10
66516089 381 PREDICTED: splicing factor 45-like [Apis 0.697 0.139 0.649 3e-10
242015516 402 Splicing factor, putative [Pediculus hum 0.473 0.089 0.833 3e-10
340719031 382 PREDICTED: splicing factor 45-like [Bomb 0.697 0.138 0.649 3e-10
350399021 383 PREDICTED: splicing factor 45-like [Bomb 0.697 0.138 0.649 4e-10
307184500 380 Splicing factor 45 [Camponotus floridanu 0.697 0.139 0.649 6e-10
156542185 383 PREDICTED: splicing factor 45 [Nasonia v 0.460 0.091 0.857 7e-10
>gi|383858690|ref|XP_003704832.1| PREDICTED: splicing factor 45-like [Megachile rotundata] Back     alignment and taxonomy information
 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%)

Query: 34  ENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTA 73
            NMVGPGEVD DLEPEVKDECNTKYG+V RVIIHE+   A
Sbjct: 292 RNMVGPGEVDDDLEPEVKDECNTKYGDVARVIIHEVTEAA 331




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332022266|gb|EGI62581.1| Splicing factor 45 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|312382254|gb|EFR27775.1| hypothetical protein AND_05136 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|322800820|gb|EFZ21695.1| hypothetical protein SINV_12429 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|66516089|ref|XP_393194.2| PREDICTED: splicing factor 45-like [Apis mellifera] gi|380028015|ref|XP_003697707.1| PREDICTED: splicing factor 45-like [Apis florea] Back     alignment and taxonomy information
>gi|242015516|ref|XP_002428399.1| Splicing factor, putative [Pediculus humanus corporis] gi|212513011|gb|EEB15661.1| Splicing factor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340719031|ref|XP_003397961.1| PREDICTED: splicing factor 45-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350399021|ref|XP_003485388.1| PREDICTED: splicing factor 45-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307184500|gb|EFN70889.1| Splicing factor 45 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|156542185|ref|XP_001599827.1| PREDICTED: splicing factor 45 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
FB|FBgn0086683403 Spf45 "Spf45" [Drosophila mela 0.723 0.136 0.563 5.9e-11
ZFIN|ZDB-GENE-040426-817418 rbm17 "RNA binding motif prote 0.552 0.100 0.577 1.8e-06
UNIPROTKB|E2RMQ0401 RBM17 "Uncharacterized protein 0.684 0.129 0.5 2.1e-06
UNIPROTKB|E1BUJ1405 RBM17 "Uncharacterized protein 0.710 0.133 0.482 2.2e-06
UNIPROTKB|A7MB77401 RBM17 "RBM17 protein" [Bos tau 0.684 0.129 0.5 2.7e-06
UNIPROTKB|Q96I25401 RBM17 "Splicing factor 45" [Ho 0.684 0.129 0.5 2.7e-06
MGI|MGI:1924188405 Rbm17 "RNA binding motif prote 0.684 0.128 0.5 2.8e-06
RGD|1311208405 Rbm17 "RNA binding motif prote 0.684 0.128 0.5 2.8e-06
UNIPROTKB|F1RUL1406 RBM17 "Uncharacterized protein 0.684 0.128 0.5 2.8e-06
TAIR|locus:2028130387 DRT111 "DNA-DAMAGE-REPAIR/TOLE 0.447 0.087 0.628 1.5e-05
FB|FBgn0086683 Spf45 "Spf45" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 159 (61.0 bits), Expect = 5.9e-11, P = 5.9e-11
 Identities = 31/55 (56%), Positives = 37/55 (67%)

Query:    14 GEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHE 68
             G++   +   +K         NMVGPG+VD +LEPEVKDECNTKYGEV  VIIHE
Sbjct:   294 GDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECNTKYGEVNSVIIHE 348


GO:0005681 "spliceosomal complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IGI
GO:0006281 "DNA repair" evidence=IMP
GO:0071011 "precatalytic spliceosome" evidence=IDA
ZFIN|ZDB-GENE-040426-817 rbm17 "RNA binding motif protein 17" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMQ0 RBM17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUJ1 RBM17 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7MB77 RBM17 "RBM17 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96I25 RBM17 "Splicing factor 45" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1924188 Rbm17 "RNA binding motif protein 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311208 Rbm17 "RNA binding motif protein 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUL1 RBM17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2028130 DRT111 "DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 111" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96I25SPF45_HUMANNo assigned EC number0.59450.47360.0897yesN/A
P42698DR111_ARATHNo assigned EC number0.61110.46050.0904yesN/A
Q8JZX4SPF45_MOUSENo assigned EC number0.59450.47360.0888yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
cd1264796 cd12647, RRM_UHM_SPF45, RNA recognition motif in U 4e-13
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 4e-09
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 2e-08
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 1e-05
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 0.001
>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
 Score = 58.1 bits (141), Expect = 4e-13
 Identities = 28/69 (40%), Positives = 35/69 (50%), Gaps = 27/69 (39%)

Query: 5  ILDLNMVGPGEVDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRV 64
          +L  NMVGPGEVD DLEPEVKEEC                           +KYG+V +V
Sbjct: 5  VLLRNMVGPGEVDEDLEPEVKEEC---------------------------SKYGKVTKV 37

Query: 65 IIHELPTTA 73
          +I E+P  +
Sbjct: 38 LIFEIPGAS 46


This subgroup corresponds to the RRM of SPF45, also termed RNA-binding motif protein 17 (RBM17), an RNA-binding protein consisting of an unstructured N-terminal region, followed by a G-patch motif and a C-terminal U2AF (U2 auxiliary factor) homology motifs (UHM) that harbors a RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain) and an Arg-Xaa-Phe sequence motif. SPF45 regulates alternative splicing of the apoptosis regulatory gene FAS (also known as CD95). It induces exon 6 skipping in FAS pre-mRNA through the UHM domain that binds to tryptophan-containing linear peptide motifs (UHM ligand motifs, ULMs) present in the 3' splice site-recognizing factors U2AF65, SF1 and SF3b155. . Length = 96

>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 76
KOG1996|consensus378 99.52
KOG0124|consensus544 99.42
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.34
KOG0147|consensus549 98.96
KOG0120|consensus500 98.83
KOG1548|consensus382 98.7
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 98.55
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.54
smart0036170 RRM_1 RNA recognition motif. 97.18
PF1551973 RBM39linker: linker between RRM2 and RRM3 domains 96.74
KOG0124|consensus544 96.09
KOG1996|consensus378 96.0
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 92.84
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 88.28
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 86.51
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 85.36
smart0036071 RRM RNA recognition motif. 81.35
>KOG1996|consensus Back     alignment and domain information
Probab=99.52  E-value=2.3e-15  Score=116.11  Aligned_cols=58  Identities=45%  Similarity=0.662  Sum_probs=54.4

Q ss_pred             CCCCCccccccccceeeeeccCCCCccccchHHHHHHHHhhcCcceEEEEEecCCCCCC
Q psy18100         16 VDSDLEPEVKEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPTTAN   74 (76)
Q Consensus        16 vd~~l~~ev~~~s~vl~L~NMv~~~e~dddl~~eV~eEC~~KyG~V~~v~I~~~~~~~~   74 (76)
                      ++++|+...+.|++||+|+|||+++++|+||++|+++|| +|||+|.+|.||..|++++
T Consensus       269 ~v~n~t~Il~~ptkvlllrnmVg~gevd~elede~keEc-eKyg~V~~viifeip~~p~  326 (378)
T KOG1996|consen  269 SVSNLTEILKCPTKVLLLRNMVGAGEVDEELEDETKEEC-EKYGKVGNVIIFEIPSQPE  326 (378)
T ss_pred             hhhhHHHHHhcchHHHHhhhhcCcccccHHHHHHHHHHH-HhhcceeeEEEEecCCCcc
Confidence            567788889999999999999999999999999999999 5999999999999999875



>KOG0124|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PF15519 RBM39linker: linker between RRM2 and RRM3 domains in RBM39 protein; PDB: 3S6E_A 2LQ5_A Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
2pe8_A105 Crystal Structure Of The Uhm Domain Of Human Spf45 2e-05
2dny_A119 Solution Structure Of The Third Rna Binding Domain 5e-04
3dxb_A222 Structure Of The Uhm Domain Of Puf60 Fused To Thior 8e-04
>pdb|2PE8|A Chain A, Crystal Structure Of The Uhm Domain Of Human Spf45 (free Form) Length = 105 Back     alignment and structure

Iteration: 1

Score = 44.3 bits (103), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/37 (59%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Query: 34 ENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELP 70 NMVG GEVD DLE E K+EC KYG+V + +I E+P Sbjct: 14 RNMVGAGEVDEDLEVETKEECE-KYGKVGKCVIFEIP 49
>pdb|2DNY|A Chain A, Solution Structure Of The Third Rna Binding Domain Of Fbp- Interacting Repressor, Siahbp1 Length = 119 Back     alignment and structure
>pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 1e-09
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 4e-07
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 3e-08
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 5e-07
2dit_A112 HIV TAT specific factor 1 variant; structural geno 2e-05
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 8e-05
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 3e-04
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
 Score = 49.4 bits (118), Expect = 1e-09
 Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 35 NMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHE 68
          NMV P ++D DLE EV +EC  K+G V RVII++
Sbjct: 27 NMVDPKDIDDDLEGEVTEECG-KFGAVNRVIIYQ 59


>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.55
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.49
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.46
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.41
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.76
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.72
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.69
2krb_A81 Eukaryotic translation initiation factor 3 subunit 96.61
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 95.22
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 94.96
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 94.94
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 94.94
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 94.57
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 94.49
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 94.41
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 94.35
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 94.01
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 93.87
1x4e_A85 RNA binding motif, single-stranded interacting pro 93.64
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 93.63
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 93.51
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 93.48
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 93.35
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 93.32
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 93.31
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 93.21
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 92.98
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 92.97
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 92.88
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 92.81
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 92.68
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 92.5
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 92.49
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 92.42
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 92.42
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 92.29
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 92.13
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 92.11
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 92.11
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 92.09
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 92.05
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 92.03
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 91.99
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 91.89
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 91.8
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 91.76
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 91.74
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 91.74
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 91.62
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 91.59
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 91.47
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 91.33
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 91.19
2la6_A99 RNA-binding protein FUS; structural genomics, nort 91.09
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 91.01
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 90.98
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 90.87
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 90.77
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 90.7
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 90.62
1x5p_A97 Negative elongation factor E; structure genomics, 90.51
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 90.48
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 90.47
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 90.43
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 90.31
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 90.15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 90.13
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 90.1
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 90.08
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 90.03
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 89.86
2kt5_A124 RNA and export factor-binding protein 2; chaperone 89.84
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 89.83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 89.82
2div_A99 TRNA selenocysteine associated protein; structural 89.77
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 89.77
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 89.55
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 89.51
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 89.5
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 89.41
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 89.4
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 89.38
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 89.3
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 89.1
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 89.08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 89.04
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 88.99
2cpj_A99 Non-POU domain-containing octamer-binding protein; 88.88
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 88.67
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 88.57
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 88.57
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 88.57
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 88.53
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 88.51
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 88.48
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 88.44
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 88.44
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 88.4
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 88.37
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 88.24
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 88.09
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 88.02
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 87.87
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 87.75
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 87.43
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 87.41
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 87.26
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 87.24
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 87.08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 87.04
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 86.99
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 86.96
2cqd_A116 RNA-binding region containing protein 1; RNA recog 86.9
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 86.73
2cph_A107 RNA binding motif protein 19; RNA recognition moti 86.48
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 86.43
2i2y_A150 Fusion protein consists of immunoglobin G- binding 86.24
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 86.04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 85.88
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 85.76
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 85.6
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 85.3
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 85.23
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 85.09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 85.08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 84.69
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 84.04
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 83.8
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 83.39
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 83.31
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 83.23
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 82.81
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 82.58
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 82.53
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 82.5
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 82.36
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 82.32
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 82.31
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 82.08
2f3j_A177 RNA and export factor binding protein 2; RRM domai 81.86
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 81.67
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 81.56
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 81.42
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 80.88
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 80.7
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 80.66
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 80.41
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
Probab=99.55  E-value=3.6e-15  Score=97.08  Aligned_cols=46  Identities=46%  Similarity=0.685  Sum_probs=42.7

Q ss_pred             ccccceeeeeccCCCCccccchHHHHHHHHhhcCcceEEEEEecCCC
Q psy18100         25 KEECNTKYGENMVGPGEVDSDLEPEVKDECNTKYGEVVRVIIHELPT   71 (76)
Q Consensus        25 ~~~s~vl~L~NMv~~~e~dddl~~eV~eEC~~KyG~V~~v~I~~~~~   71 (76)
                      ++||+||+|+|||+|+|+++||++||++|| +|||.|.+|.|++...
T Consensus        17 ~~ps~vl~L~Nm~~~~el~ddleedl~eef-~k~G~V~~v~I~~~~~   62 (118)
T 3ue2_A           17 KQESTVMVLRNMVDPKDIDDDLEGEVTEEC-GKFGAVNRVIIYQEKQ   62 (118)
T ss_dssp             HHSCCEEEEESCSCGGGCCTTHHHHHHHHH-TTTSCEEEEEEEEEEE
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHHH-hccCCEeEEEEeecCC
Confidence            368999999999999999999999999999 6999999999998753



>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.51
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 97.59
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 97.03
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 96.82
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 96.08
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 95.99
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 95.94
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 95.83
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 95.7
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 95.63
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 95.47
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 95.42
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 95.24
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 95.09
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 94.85
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 94.47
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 93.98
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 93.55
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 93.54
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 93.33
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 93.13
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 93.01
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 92.72
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 92.6
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 92.51
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 92.38
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 92.27
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 91.88
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 91.86
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 91.77
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 91.42
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 90.86
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 90.77
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 90.72
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 90.47
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.42
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 90.41
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 90.26
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.04
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 89.93
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 89.53
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 89.22
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 89.08
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 88.47
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 88.34
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 88.16
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 88.15
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 88.12
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 88.07
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 87.99
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 87.75
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 87.64
d2cpja186 Non-POU domain-containing octamer-binding protein, 86.77
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 86.61
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 86.12
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 85.98
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 85.52
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 85.31
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 85.2
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 85.2
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 83.05
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 82.55
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 80.77
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 80.74
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicing factor U2AF 65 KDa subunit
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.51  E-value=8.9e-15  Score=91.10  Aligned_cols=47  Identities=30%  Similarity=0.384  Sum_probs=41.7

Q ss_pred             ccccceeeeeccCCCCcccc-----chHHHHHHHHhhcCcceEEEEEecCCCC
Q psy18100         25 KEECNTKYGENMVGPGEVDS-----DLEPEVKDECNTKYGEVVRVIIHELPTT   72 (76)
Q Consensus        25 ~~~s~vl~L~NMv~~~e~dd-----dl~~eV~eEC~~KyG~V~~v~I~~~~~~   72 (76)
                      |+||+||+|+|||+++++.+     ++.+||++|| +|||.|.+|.|++.+..
T Consensus         1 g~Ps~vl~l~N~~~~~~l~~~~~~~~i~edi~~e~-~k~G~v~~v~I~~~~~~   52 (104)
T d1o0pa_           1 GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDEC-SKYGLVKSIEIPRPVDG   52 (104)
T ss_dssp             CCCCSEEEEESSCCTTTTTSHHHHHHHHHHHHHHH-TTTSCEEEEECCCCTTS
T ss_pred             CCCCcEEEEeCCCCHHHcCCchhHHHHHHHHHHHh-cccCceEEEEEeecCCC
Confidence            57999999999999999864     5889999999 69999999999986544



>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure