Diaphorina citri psyllid: psy18105


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR
cHHHHHHHHcccccccccccccEEEEcccEEEEEccHHHHHHcccccEEEEEccccccHHHHHHHHHHEEcccEEEEEccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccEEEccccccccccccccccccHHHHHHHHHHHccccccccccHHHHccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHccccccccEEEEEcccccccccccc
*****************DDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITP***********************TQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPE*NKALVR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-acetyltransferase 10 Has protein acetyltransferase activity in vitro. Can acetylate both histones and microtubules. Histone acetylation may regulate transcription and mitotic chromosome de-condensation. Activates telomerase activity by stimulating the transcription of TERT, and may also regulate telomerase function by affecting the balance of telomerase subunit assembly, disassembly, and localization. Acetylates alpha-tubulin, which may affect microtubule stability and cell division.confidentQ8K224
Polycomb protein l(1)G0020 Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via the methylation of histones, rendering chromatin heritably changed in its expressibility.confidentQ9W3C1
UPF0202 protein KRE33 confidentP53914

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030686 [CC]90S preribosomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZPA, chain A
Confidence level:very confident
Coverage over the Query: 39-151,169-197,212-213,255-321
View the alignment between query and template
View the model in PyMOL
Template: 2ZPA, chain A
Confidence level:confident
Coverage over the Query: 207-229
View the alignment between query and template
View the model in PyMOL