Psyllid ID: psy18105

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR
cHHHHHHHHcccccccccccccEEEEcccEEEEEccHHHHHHcccccEEEEEccccccHHHHHHHHHHEEcccEEEEEccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccEEEccccccccccccccccccHHHHHHHHHHHccccccccccHHHHccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHccccccccEEEEEcccccccccccc
cHHHHHHHHccccccccccccEEEEEcccEEEEEEccHHHHHcccccEEEEHcHHHccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEccccEcEccccccEcccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHccccHccccEEEEcccHHHccEEEc
MKSVQRKVQagklnvneddpfeLFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHEryrteahsDVVCRFNERFLLSLsscnrclvvddqltvlpitsqhvlnitpvsktsdlSQQEQELNALKTSlkdtqpvsALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAfgysnifvtspspenlNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR
mksvqrkvqagklnvneddpfeLFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFidsisektlRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDysivqstepeynkalvr
MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVlllrtlsslkqlYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSaalglavagavaFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSaalglavagavaFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR
******************DPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITP*************************PVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQ************
*****************DDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQ******************************TQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRS**************ALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPE*NKALVR
********QAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR
*KS*QRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVS****LSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query333 2.2.26 [Sep-21-2011]
Q9H0A0 1025 N-acetyltransferase 10 OS yes N/A 0.846 0.275 0.610 1e-112
Q8K224 1024 N-acetyltransferase 10 OS yes N/A 0.846 0.275 0.625 1e-111
P53914 1056 UPF0202 protein KRE33 OS= yes N/A 0.840 0.265 0.545 1e-103
Q55EJ3 1057 N-acetyltransferase 10 ho yes N/A 0.798 0.251 0.557 4e-97
Q9W3C1 1008 Polycomb protein l(1)G002 yes N/A 0.843 0.278 0.519 2e-93
P87115 1033 UPF0202 protein C20G8.09c yes N/A 0.837 0.270 0.542 3e-91
O01757 1043 UPF0202 protein F55A12.8 yes N/A 0.792 0.253 0.514 1e-90
Q9XIK4 1028 UPF0202 protein At1g10490 yes N/A 0.843 0.273 0.495 2e-79
Q9M2Q4 1028 UPF0202 protein At3g57940 no N/A 0.843 0.273 0.492 3e-78
Q8TYZ5 855 Putative tRNA(Met) cytidi yes N/A 0.564 0.219 0.3 6e-16
>sp|Q9H0A0|NAT10_HUMAN N-acetyltransferase 10 OS=Homo sapiens GN=NAT10 PE=1 SV=2 Back     alignment and function desciption
 Score =  406 bits (1043), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 248/336 (73%), Gaps = 54/336 (16%)

Query: 1   MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPN 60
           M+ +Q+K++ G LN+ +DDPFELF+A+TNIRY YY+ETHKILGNT+GMCVLQDFEALTPN
Sbjct: 73  MRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGMCVLQDFEALTPN 132

Query: 61  LLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLS 120
           LLART+ETVEGGG++V+LLRT++SLKQLYT++MD+H RYRTEAH DVV RFNERF+LSL+
Sbjct: 133 LLARTVETVEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLA 192

Query: 121 SCNRCLVVDDQLTVLPITSQHVLN---ITPVSKTSDLSQQEQELNALKTSLKDTQPVSAL 177
           SC +CLV+DDQL +LPI+S HV     + P +    L   + EL  LK SL+DTQPV  L
Sbjct: 193 SCKKCLVIDDQLNILPISS-HVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVL 251

Query: 178 IDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFG 237
           +DCCKTLDQ KA+LKFI+ ISEKTLRSTV+LTAARGRGKSAALGLA+AGAVAFGYSNIF 
Sbjct: 252 VDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAALGLAIAGAVAFGYSNIF- 310

Query: 238 KALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNT 297
                                                            VTSPSP+NL+T
Sbjct: 311 -------------------------------------------------VTSPSPDNLHT 321

Query: 298 FFQFIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR 333
            F+F+FKGFDAL YQEHLDY I+QS  PE+NKA++R
Sbjct: 322 LFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIR 357
Has protein acetyltransferase activity in vitro. Can acetylate both histones and microtubules. Histone acetylation may regulate transcription and mitotic chromosome de-condensation. Activates telomerase activity by stimulating the transcription of TERT, and may also regulate telomerase function by affecting the balance of telomerase subunit assembly, disassembly, and localization. Acetylates alpha-tubulin, which may affect microtubule stability and cell division.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|Q8K224|NAT10_MOUSE N-acetyltransferase 10 OS=Mus musculus GN=Nat10 PE=2 SV=1 Back     alignment and function description
>sp|P53914|KRE33_YEAST UPF0202 protein KRE33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE33 PE=1 SV=1 Back     alignment and function description
>sp|Q55EJ3|NAT10_DICDI N-acetyltransferase 10 homolog OS=Dictyostelium discoideum GN=nat10 PE=3 SV=1 Back     alignment and function description
>sp|Q9W3C1|U202_DROME Polycomb protein l(1)G0020 OS=Drosophila melanogaster GN=l(1)G0020 PE=1 SV=2 Back     alignment and function description
>sp|P87115|YDK9_SCHPO UPF0202 protein C20G8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.09c PE=3 SV=1 Back     alignment and function description
>sp|O01757|YIL8_CAEEL UPF0202 protein F55A12.8 OS=Caenorhabditis elegans GN=F55A12.8 PE=3 SV=1 Back     alignment and function description
>sp|Q9XIK4|U202A_ARATH UPF0202 protein At1g10490 OS=Arabidopsis thaliana GN=At1g10490 PE=2 SV=2 Back     alignment and function description
>sp|Q9M2Q4|U202B_ARATH UPF0202 protein At3g57940 OS=Arabidopsis thaliana GN=At3g57940 PE=2 SV=2 Back     alignment and function description
>sp|Q8TYZ5|TMCA_METKA Putative tRNA(Met) cytidine acetyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0146 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
270005385 1011 hypothetical protein TcasGA2_TC007435 [T 0.846 0.278 0.669 1e-126
189236459 988 PREDICTED: similar to predicted protein 0.846 0.285 0.669 1e-126
432861311 1037 PREDICTED: N-acetyltransferase 10-like [ 0.846 0.271 0.633 1e-121
61098422 1019 N-acetyltransferase 10 [Gallus gallus] g 0.846 0.276 0.627 1e-120
156406979 1001 predicted protein [Nematostella vectensi 0.846 0.281 0.633 1e-120
291233977 1024 PREDICTED: nat10 protein-like [Saccoglos 0.846 0.275 0.622 1e-119
390350173 1039 PREDICTED: N-acetyltransferase 10 [Stron 0.846 0.271 0.630 1e-119
242006793 1011 N-acetyltransferase, putative [Pediculus 0.843 0.277 0.675 1e-119
307179465 999 N-acetyltransferase 10 [Camponotus flori 0.843 0.281 0.657 1e-118
193652460 1016 PREDICTED: n-acetyltransferase 10-like [ 0.846 0.277 0.675 1e-118
>gi|270005385|gb|EFA01833.1| hypothetical protein TcasGA2_TC007435 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 223/333 (66%), Positives = 257/333 (77%), Gaps = 51/333 (15%)

Query: 1   MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPN 60
           MK +Q K+Q GKL+VNEDDPFELF++ST IRY YYSETHKILGNT+GMCVLQDFEALTPN
Sbjct: 73  MKQLQHKIQTGKLSVNEDDPFELFLSSTKIRYCYYSETHKILGNTFGMCVLQDFEALTPN 132

Query: 61  LLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLS 120
           LLARTIETVEGGG++V+LLR+++SLKQLYTMSMD+H+R+RTEAH D+VCRFNERFLLSL+
Sbjct: 133 LLARTIETVEGGGLVVILLRSVASLKQLYTMSMDVHQRFRTEAHQDIVCRFNERFLLSLA 192

Query: 121 SCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDC 180
           SC RCLVVDDQL+VLPI+S H L++TPV  + +    E EL  LK  L+DTQPV  LI+C
Sbjct: 193 SCKRCLVVDDQLSVLPISS-HNLHVTPVEPSQEPLPSESELTDLKNQLRDTQPVGNLINC 251

Query: 181 CKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKAL 240
           CKTLDQGKALLKFI++ISEKTLRSTVSLTAARGRGKSAALGL+VA AVAFGYSNIF    
Sbjct: 252 CKTLDQGKALLKFIEAISEKTLRSTVSLTAARGRGKSAALGLSVAAAVAFGYSNIF---- 307

Query: 241 LKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQ 300
                                                         VTSPSPENLNTFF+
Sbjct: 308 ----------------------------------------------VTSPSPENLNTFFE 321

Query: 301 FIFKGFDALAYQEHLDYSIVQSTEPEYNKALVR 333
           F+FKGFDAL YQEH+DYS+VQST PE+NKA+VR
Sbjct: 322 FVFKGFDALEYQEHIDYSLVQSTNPEFNKAIVR 354

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189236459|ref|XP_973989.2| PREDICTED: similar to predicted protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|432861311|ref|XP_004069605.1| PREDICTED: N-acetyltransferase 10-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|61098422|ref|NP_001012958.1| N-acetyltransferase 10 [Gallus gallus] gi|53133462|emb|CAG32060.1| hypothetical protein RCJMB04_16p3 [Gallus gallus] Back     alignment and taxonomy information
>gi|156406979|ref|XP_001641322.1| predicted protein [Nematostella vectensis] gi|156228460|gb|EDO49259.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|291233977|ref|XP_002736929.1| PREDICTED: nat10 protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|390350173|ref|XP_782047.3| PREDICTED: N-acetyltransferase 10 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|242006793|ref|XP_002424229.1| N-acetyltransferase, putative [Pediculus humanus corporis] gi|212507598|gb|EEB11491.1| N-acetyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307179465|gb|EFN67789.1| N-acetyltransferase 10 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|193652460|ref|XP_001949757.1| PREDICTED: n-acetyltransferase 10-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
RGD|1306717 1024 Nat10 "N-acetyltransferase 10 0.705 0.229 0.648 1.1e-82
UNIPROTKB|D4AEB4 909 RGD1306717 "RCG26113, isoform 0.705 0.258 0.648 1.1e-82
UNIPROTKB|E2RBB4 1025 NAT10 "Uncharacterized protein 0.705 0.229 0.644 2.8e-82
UNIPROTKB|F1MPG7 1026 NAT10 "Uncharacterized protein 0.705 0.229 0.644 3.6e-82
MGI|MGI:2138939 1024 Nat10 "N-acetyltransferase 10" 0.705 0.229 0.648 4.5e-82
ZFIN|ZDB-GENE-040426-1543 1025 nat10 "N-acetyltransferase 10" 0.705 0.229 0.661 1.2e-81
UNIPROTKB|F1SGS7 1028 NAT10 "Uncharacterized protein 0.705 0.228 0.635 1.5e-81
UNIPROTKB|E7ESU4 953 NAT10 "N-acetyltransferase 10" 0.705 0.246 0.631 1.9e-81
UNIPROTKB|Q9H0A0 1025 NAT10 "N-acetyltransferase 10" 0.705 0.229 0.631 1.9e-81
ASPGD|ASPL0000056220 1076 AN0247 [Emericella nidulans (t 0.699 0.216 0.570 3.1e-68
RGD|1306717 Nat10 "N-acetyltransferase 10 (GCN5-related)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 806 (288.8 bits), Expect = 1.1e-82, Sum P(2) = 1.1e-82
 Identities = 155/239 (64%), Positives = 185/239 (77%)

Query:     1 MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPN 60
             M+ +Q+K+++G LN+ +DDPFELFVA+TNIRY YY+ETHKILGNT+GMCVLQDFEALTPN
Sbjct:    73 MRQLQKKIKSGTLNIKQDDPFELFVAATNIRYCYYNETHKILGNTFGMCVLQDFEALTPN 132

Query:    61 LLARTIETVEGGGVIVXXXXXXXXXXXXYTMSMDIHERYRTEAHSDVVCRFNERFLLSLS 120
             LLART+ETVEGGG++V            YTM+MD+H RYRTEAH DVV RFNERF+LSL+
Sbjct:   133 LLARTVETVEGGGLVVILLRTMNSLKQLYTMTMDVHSRYRTEAHQDVVGRFNERFILSLA 192

Query:   121 SCNRCLVVDDQLTVLPITSQHVLNIT---PVSKTSDLSQQEQELNALKTSLKDTQPVSAL 177
             SC +CLV+DDQL +LPI+S HV +I    P +   +LS    EL  LK SL+DTQPV  L
Sbjct:   193 SCKKCLVIDDQLNILPISS-HVASIEALPPQAPDENLSPAALELQELKESLQDTQPVGVL 251

Query:   178 IDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSXXXXXXXXXXXXFGYSNIF 236
             +DCCKTLDQ KA+LKFI+ ISEKTLRSTV+LTAARGRGKS            FGYSNIF
Sbjct:   252 VDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAALGLAIAGAVAFGYSNIF 310
GO:0008080 "N-acetyltransferase activity" evidence=IEA
UNIPROTKB|D4AEB4 RGD1306717 "RCG26113, isoform CRA_d" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBB4 NAT10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPG7 NAT10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2138939 Nat10 "N-acetyltransferase 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1543 nat10 "N-acetyltransferase 10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS7 NAT10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E7ESU4 NAT10 "N-acetyltransferase 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H0A0 NAT10 "N-acetyltransferase 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056220 AN0247 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53914KRE33_YEASTNo assigned EC number0.54540.84080.2651yesN/A
Q9W3C1U202_DROMENo assigned EC number0.51950.84380.2787yesN/A
Q8K224NAT10_MOUSE2, ., 3, ., 1, ., -0.6250.84680.2753yesN/A
Q9H0A0NAT10_HUMAN2, ., 3, ., 1, ., -0.61010.84680.2751yesN/A
Q55EJ3NAT10_DICDI2, ., 3, ., 1, ., -0.55760.79870.2516yesN/A
P87115YDK9_SCHPONo assigned EC number0.54240.83780.2700yesN/A
O01757YIL8_CAEELNo assigned EC number0.51410.79270.2531yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
COG1444 758 COG1444, COG1444, Predicted P-loop ATPase fused to 8e-56
pfam0835192 pfam08351, DUF1726, Domain of unknown function (DU 3e-47
pfam05127160 pfam05127, Helicase_RecD, Helicase 5e-14
>gnl|CDD|224361 COG1444, COG1444, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information 
 Score =  193 bits (492), Expect = 8e-56
 Identities = 89/331 (26%), Positives = 122/331 (36%), Gaps = 73/331 (22%)

Query: 3   SVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLL 62
           +++R   AG       DPFE         +  Y E+ +ILG T+ + VL   E L PN L
Sbjct: 55  ALKRDALAGDRLPESPDPFEG-----EFEHIDYKESERILGRTFDLLVLDLTEGLDPNAL 109

Query: 63  ARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSC 122
           AR + TV GGG++VLLL      K L T       R       DV  RFN RF+ SLS+ 
Sbjct: 110 ARLVGTVRGGGLLVLLLPPWEEWKTLPTA---DSRRLSVPPFPDVTPRFNRRFIRSLSAH 166

Query: 123 NRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCK 182
              + +DD                   ++  +S  E      K  L    P   L + C 
Sbjct: 167 PDGIFIDDVD-------------PKKIESGPVSANEPSKERKKPPLDPVFP-RELYELCL 212

Query: 183 TLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLK 242
           T DQ +AL      +     +  + LTA RGRGKSAALG+A+A A               
Sbjct: 213 TEDQAEALEILERLLDAP--KRALVLTADRGRGKSAALGIALAAAARLA----------- 259

Query: 243 FIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFI 302
                                                 G   I VT+P+P N+ T F+F 
Sbjct: 260 --------------------------------------GSVRIIVTAPTPANVQTLFEFA 281

Query: 303 FKGFDALAYQEHLDYSIVQSTEPEYNKALVR 333
            KG + L Y+  +    +             
Sbjct: 282 GKGLEFLGYKRKVAPDALGEIREVSGDGFRI 312

Length = 758
>gnl|CDD|149420 pfam08351, DUF1726, Domain of unknown function (DUF1726) Back     alignment and domain information
>gnl|CDD|218449 pfam05127, Helicase_RecD, Helicase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 333
KOG2036|consensus 1011 100.0
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 100.0
PF0835192 DUF1726: Domain of unknown function (DUF1726); Int 99.96
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 99.72
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 98.56
PHA03333 752 putative ATPase subunit of terminase; Provisional 98.41
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.18
KOG1803|consensus 649 96.53
KOG2036|consensus 1011 96.52
PF1324576 AAA_19: Part of AAA domain 96.44
TIGR00376 637 DNA helicase, putative. The gene product may repre 96.25
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.17
smart00487201 DEXDc DEAD-like helicases superfamily. 95.98
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.93
PHA03333 752 putative ATPase subunit of terminase; Provisional 95.61
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 95.31
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.11
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 95.03
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 94.79
PRK08939306 primosomal protein DnaI; Reviewed 94.7
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 94.64
PRK13889 988 conjugal transfer relaxase TraA; Provisional 94.56
PF10236 309 DAP3: Mitochondrial ribosomal death-associated pro 94.51
PF04851184 ResIII: Type III restriction enzyme, res subunit; 94.46
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 94.38
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 94.3
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.94
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.88
PRK10689 1147 transcription-repair coupling factor; Provisional 93.76
PF05729166 NACHT: NACHT domain 93.7
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 93.66
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 93.44
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 93.4
PRK08903 227 DnaA regulatory inactivator Hda; Validated 93.24
PRK06921266 hypothetical protein; Provisional 93.22
PRK13826 1102 Dtr system oriT relaxase; Provisional 92.84
PRK08116268 hypothetical protein; Validated 92.8
PRK12377248 putative replication protein; Provisional 92.77
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 92.71
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 92.6
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 92.43
PRK08084 235 DNA replication initiation factor; Provisional 92.39
PRK05642 234 DNA replication initiation factor; Validated 92.15
PRK10875 615 recD exonuclease V subunit alpha; Provisional 92.04
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 91.96
PF13173128 AAA_14: AAA domain 91.94
PRK07952244 DNA replication protein DnaC; Validated 91.67
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 91.44
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 91.22
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 91.11
PRK14974 336 cell division protein FtsY; Provisional 91.1
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 91.06
PRK06835329 DNA replication protein DnaC; Validated 90.98
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 90.64
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 90.39
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 90.15
PRK06851 367 hypothetical protein; Provisional 90.1
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 90.02
PRK08727 233 hypothetical protein; Validated 90.0
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 89.97
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 89.81
COG1484254 DnaC DNA replication protein [DNA replication, rec 89.36
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 89.23
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 89.06
cd03281 213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 88.96
PRK09183259 transposase/IS protein; Provisional 88.84
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 88.74
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 88.73
PRK01172 674 ski2-like helicase; Provisional 88.51
PRK08181269 transposase; Validated 88.49
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 88.47
PRK12608 380 transcription termination factor Rho; Provisional 88.32
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 88.09
PHA02558 501 uvsW UvsW helicase; Provisional 88.05
PRK00411 394 cdc6 cell division control protein 6; Reviewed 87.96
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 87.94
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 87.84
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 87.75
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 87.71
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 87.7
PF00004132 AAA: ATPase family associated with various cellula 87.59
PHA02533 534 17 large terminase protein; Provisional 87.53
KOG1802|consensus 935 87.48
PRK07667193 uridine kinase; Provisional 87.42
smart00382148 AAA ATPases associated with a variety of cellular 87.34
PRK05580 679 primosome assembly protein PriA; Validated 86.54
PHA02653 675 RNA helicase NPH-II; Provisional 86.28
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 86.23
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 86.11
PTZ00424 401 helicase 45; Provisional 86.11
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 86.09
PRK00254 720 ski2-like helicase; Provisional 85.99
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 85.91
PRK09401 1176 reverse gyrase; Reviewed 85.71
PF1355562 AAA_29: P-loop containing region of AAA domain 85.63
PRK02362 737 ski2-like helicase; Provisional 85.56
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 85.52
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 85.38
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 85.22
PRK04296 190 thymidine kinase; Provisional 85.09
PRK00698 205 tmk thymidylate kinase; Validated 85.02
PRK08154309 anaerobic benzoate catabolism transcriptional regu 84.99
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 84.87
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 84.87
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 84.71
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 84.61
PF01935 229 DUF87: Domain of unknown function DUF87; InterPro: 84.44
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 84.25
KOG0922|consensus 674 84.18
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 84.12
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 84.01
cd01672 200 TMPK Thymidine monophosphate kinase (TMPK), also k 83.98
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 83.93
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 83.4
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 83.26
TIGR00064 272 ftsY signal recognition particle-docking protein F 83.23
PRK06893 229 DNA replication initiation factor; Validated 82.9
cd01128 249 rho_factor Transcription termination factor rho is 82.86
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 82.68
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 82.32
PRK03846198 adenylylsulfate kinase; Provisional 81.98
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 81.82
PRK12422 445 chromosomal replication initiation protein; Provis 81.79
PRK00149 450 dnaA chromosomal replication initiation protein; R 81.71
PRK05057172 aroK shikimate kinase I; Reviewed 81.7
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 81.69
PRK00300 205 gmk guanylate kinase; Provisional 81.62
PRK06526254 transposase; Provisional 81.51
PF00448 196 SRP54: SRP54-type protein, GTPase domain; InterPro 81.37
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 81.36
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 81.3
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 81.14
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 81.08
PF12846 304 AAA_10: AAA-like domain 81.05
COG4559 259 ABC-type hemin transport system, ATPase component 80.94
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 80.94
PRK06851367 hypothetical protein; Provisional 80.87
PRK08533 230 flagellar accessory protein FlaH; Reviewed 80.76
PRK10416 318 signal recognition particle-docking protein FtsY; 80.76
PRK00131175 aroK shikimate kinase; Reviewed 80.75
KOG1805|consensus 1100 80.69
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 80.64
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 80.51
PRK13949169 shikimate kinase; Provisional 80.43
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 80.37
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 80.36
COG3640 255 CooC CO dehydrogenase maturation factor [Cell divi 80.3
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 80.15
>KOG2036|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.4e-69  Score=547.86  Aligned_cols=282  Identities=68%  Similarity=1.129  Sum_probs=258.0

Q ss_pred             ChhhhhHHhcCcCCCCCCCcchhhhhccccceeehhhhhhhcccccceEEEecCCCCCHHHHHHHhhhhccCcEEEEEeC
Q psy18105          1 MKSVQRKVQAGKLNVNEDDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLR   80 (333)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~f~~~~~i~~~~yk~a~~lLGqE~d~lIlD~~~gl~PNaLaalaGTVrGGGlLILL~P   80 (333)
                      +|.+|+.+++|.++.+.+|+|++|+++++|+||+|++++++||+||+|||+|+|++++||.||+++|||+|||++|||+.
T Consensus        72 ~kk~kk~~~~g~~~~~~~D~f~lFi~~~~I~~cyYkEsekILGnT~gmciLQDFEALTPNLLArTiETVeGGGlVVLLL~  151 (1011)
T KOG2036|consen   72 AKKIKKAIKRGTLDPNSEDPFSLFISSTNIRYCYYKESEKILGNTFGMCILQDFEALTPNLLARTIETVEGGGLVVLLLK  151 (1011)
T ss_pred             HHHHHHHHhccCCCccccCcHHHHhhccceEEEEeccHHHhhccccceEEeehhhhcChhhhhheeeeeecCcEEEEeHh
Confidence            36789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccchhhhhcccccccccccccCCcCcchhHHHHHHHhhhcCCceEEEeCCCCccccccccccccccCCCCC--cchhhH
Q psy18105         81 TLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTS--DLSQQE  158 (333)
Q Consensus        81 ~~~~w~~~~~~~~~~~~r~~~~~~~~v~~rF~~Rf~~~L~~~~~~~i~d~~~~~lp~~~~~~~~~~~~~~~~--~~~~~~  158 (333)
                      ++.+++++|+++||.|.||.++.|.++++||++||+.+|.+|+.|+++||+.+++|+++ +...++++|+..  ..++.+
T Consensus       152 sl~SLkqLyTm~mDVH~R~rTEaH~ev~~RfNeRfilSLasc~~clv~DDeLnvLplss-h~~nv~~~P~~~~~~~~~~e  230 (1011)
T KOG2036|consen  152 SLNSLKQLYTMSMDVHSRYRTEAHSEVTARFNERFILSLASCKNCLVLDDELNVLPLSS-HIKNVEAVPPKDDENLSPSE  230 (1011)
T ss_pred             hhhhHHhHHheeeeHHhhhccccchhhhhhhhHHHHHHHhcCCceEEEcCccccccccc-cccccccCCCcccccCChhh
Confidence            99999999999999999999999999999999999999999999999999999999976 555666777533  244567


Q ss_pred             HHHHHhhhccccCCcchhhhccCCCHHHHHHHHHHHHHHhhhcccceeeEEecCCCChhhhhhhhhhhhhhcccchhhhh
Q psy18105        159 QELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGK  238 (333)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~l~~~~~T~dQ~~al~~l~~~~~~~~~r~~lvlTAdRGRGKSAaLGla~~~~~~~~~~n~~~~  238 (333)
                      .++.+|++++.+.+|++.|+.+|.|.||++|+..|.+++.++                                      
T Consensus       231 ~~lk~Lkesl~~~~P~G~Lv~~~kT~dQakav~~f~dai~eK--------------------------------------  272 (1011)
T KOG2036|consen  231 RELKELKESLSDDQPAGPLVGLCKTLDQAKAVLTFFDAIVEK--------------------------------------  272 (1011)
T ss_pred             hhhHhhhhhhcCCCcchhhhhhhhhHHHHHHHHHHHHHHHHh--------------------------------------
Confidence            889999999999999999999999999999998887665554                                      


Q ss_pred             hhhhhhhccchhccccceeeeeccCCCchhHHHHHHHHHHHcCCceEEEeCCChhhHHHHHHHHHhcchhcccccccceE
Q psy18105        239 ALLKFIDGISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLDYS  318 (333)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~vltA~RGRGKSallGla~a~~~~~g~~~I~VTAPs~~~v~tlf~fa~~~L~~lg~~~~~d~~  318 (333)
                                  .+|.++.|||.|||||||+|||++|++++.||+||+||+|+|+|+.|||+|+.+|+++|+|+||+||+
T Consensus       273 ------------~lr~~vsLtA~RGRGKSAALGlsiA~AVa~GysnIyvtSPspeNlkTlFeFv~kGfDaL~Yqeh~Dy~  340 (1011)
T KOG2036|consen  273 ------------TLRSTVSLTASRGRGKSAALGLSIAGAVAFGYSNIYVTSPSPENLKTLFEFVFKGFDALEYQEHVDYD  340 (1011)
T ss_pred             ------------hhcceEEEEecCCCCchhhhhHHHHHHHhcCcceEEEcCCChHHHHHHHHHHHcchhhhcchhhcchh
Confidence                        44555555666666666666999999999999999999999999999999999999999999999999


Q ss_pred             EEecCCcccccccCC
Q psy18105        319 IVQSTEPEYNKALVR  333 (333)
Q Consensus       319 ~i~~~~~~~~~~~~~  333 (333)
                      ||||++|+|++||+|
T Consensus       341 iI~s~np~fkkaivR  355 (1011)
T KOG2036|consen  341 IIQSTNPDFKKAIVR  355 (1011)
T ss_pred             hhhhcChhhhhhEEE
Confidence            999999999999986

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF08351 DUF1726: Domain of unknown function (DUF1726); InterPro: IPR013562 This entry represents a protein of unknown function and is found towards the N terminus of putative ATPases (IPR007807 from INTERPRO) Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>KOG2036|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 1e-41
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-04
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Length = 671 Back     alignment and structure
 Score =  152 bits (385), Expect = 1e-41
 Identities = 39/303 (12%), Positives = 71/303 (23%), Gaps = 94/303 (31%)

Query: 18  DDPFELFVASTNIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVL 77
            D   +        +   S    +LG  +   V            A    T++ G  +VL
Sbjct: 45  GDWLWISPRPDAENHCSPSALQTLLGREFRHAVFDARHGFDAAAFAALSGTLKAGSWLVL 104

Query: 78  LLRTLSSLKQLYTMSMDIHERYRTEAHSDVVCRFNERFLLSLSSCNRCLVV-DDQLTVLP 136
           LL      +           R+           F +     L++ N  ++   +Q   L 
Sbjct: 105 LLPVWEEWENQPDAD---SLRWSDCPDPIATPHFVQHLKRVLTADNEAILWRQNQPFSLA 161

Query: 137 ITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGKALLKFIDS 196
             +                                +            +Q + L + +  
Sbjct: 162 HFTP-------------------------------RTDWYPATGAPQPEQQQLLKQLM-- 188

Query: 197 ISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTV 256
                     ++TAARGRGKSA  G  ++                          +    
Sbjct: 189 ---TMPPGVAAVTAARGRGKSALAGQLISR-------------------------IAGRA 220

Query: 257 SLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQEHLD 316
            +TA                             P+  + +   QF  + F  +A    L 
Sbjct: 221 IVTA-----------------------------PAKASTDVLAQFAGEKFRFIAPDALLA 251

Query: 317 YSI 319
              
Sbjct: 252 SDE 254
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 100.0
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.33
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 97.29
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 96.72
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 95.85
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.55
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 95.49
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 95.22
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.16
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.12
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 94.98
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 94.82
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 94.81
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 94.68
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 94.53
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 94.45
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 94.27
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.21
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 94.16
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 94.07
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 93.94
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 93.93
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 93.89
3bor_A237 Human initiation factor 4A-II; translation initiat 93.86
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 93.85
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 93.84
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 93.81
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 93.71
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 93.67
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 93.56
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 93.43
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 93.34
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 93.04
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 93.03
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 92.84
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 92.78
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 92.68
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 92.66
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 92.66
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 92.57
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 92.42
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.36
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 92.3
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 92.29
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 92.24
3bos_A 242 Putative DNA replication factor; P-loop containing 92.2
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 92.15
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 92.1
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 91.83
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 91.81
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 91.76
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 91.7
2orw_A 184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.57
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 91.49
2o0j_A 385 Terminase, DNA packaging protein GP17; nucleotide- 91.44
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 91.34
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 91.25
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 91.18
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 91.1
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 91.09
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 91.07
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 90.89
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 90.83
3b6e_A216 Interferon-induced helicase C domain-containing P; 90.79
2qgz_A308 Helicase loader, putative primosome component; str 90.67
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 90.47
3h1t_A 590 Type I site-specific restriction-modification syst 90.38
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 89.68
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.46
2chg_A 226 Replication factor C small subunit; DNA-binding pr 89.35
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 89.21
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 88.91
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 88.91
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 88.82
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 88.67
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 88.12
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 87.46
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 86.63
2fna_A 357 Conserved hypothetical protein; structural genomic 86.33
1yks_A 440 Genome polyprotein [contains: flavivirin protease 86.13
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 86.11
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 85.92
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 85.89
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 85.89
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 85.6
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 85.54
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 85.54
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 85.53
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 85.17
1kag_A173 SKI, shikimate kinase I; transferase, structural g 84.85
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 84.79
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 84.65
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 84.61
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 84.51
4gl2_A 699 Interferon-induced helicase C domain-containing P; 84.37
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 84.19
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 84.17
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 84.05
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 83.58
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 83.29
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 83.27
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 83.16
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 83.14
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 83.01
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 83.0
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 82.87
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 82.86
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 82.67
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 82.53
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 82.5
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 82.41
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 82.27
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 82.26
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 82.12
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 81.92
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 81.71
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 81.7
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 81.05
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 80.93
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 80.63
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 80.61
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 80.5
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 80.4
2og2_A 359 Putative signal recognition particle receptor; nuc 80.4
4a74_A 231 DNA repair and recombination protein RADA; hydrola 80.18
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 80.15
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 80.02
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=4.3e-42  Score=358.16  Aligned_cols=201  Identities=21%  Similarity=0.267  Sum_probs=154.7

Q ss_pred             ccceeehhhhhhhcccccceEEEecCCCCCHHHHHHHhhhhccCcEEEEEeCCccchhhhhcccccccccccccCCcCcc
Q psy18105         29 NIRYTYYSETHKILGNTYGMCVLQDFEALTPNLLARTIETVEGGGVIVLLLRTLSSLKQLYTMSMDIHERYRTEAHSDVV  108 (333)
Q Consensus        29 ~i~~~~yk~a~~lLGqE~d~lIlD~~~gl~PNaLaalaGTVrGGGlLILL~P~~~~w~~~~~~~~~~~~r~~~~~~~~v~  108 (333)
                      .+++|+|++++++|||||+++|||++++|+||+||+++|||+|||++|||+|+|++|+++++   .++.||....+.+++
T Consensus        56 ~~~~~~~~~~~~~LG~e~~~~v~d~~~~~~pn~la~~~gtv~gGG~lvll~p~~~~w~~~~d---~~~~r~~~~~~~~~~  132 (671)
T 2zpa_A           56 AENHCSPSALQTLLGREFRHAVFDARHGFDAAAFAALSGTLKAGSWLVLLLPVWEEWENQPD---ADSLRWSDCPDPIAT  132 (671)
T ss_dssp             ----------CCTTTCCBSSEEEECSSCCCHHHHHHHHTTBCTTCEEEEEESCGGGTTTSCB---GGGHHHHCCSSCBCC
T ss_pred             cccccCHHHHHHhhCCccCEEEEEcCCCCCHHHHHHHhhheecceEEEEEcCChhhhhhcCC---hhhhccccccCCccc
Confidence            45899999999999999999999999999999999999999999999999999999999853   445666666778899


Q ss_pred             hhHHHHHHHhhhcCCceEEEeCCCCccccccccccccccCCCCCcchhhHHHHHHhhhccccCCcchhhhccCCCHHHHH
Q psy18105        109 CRFNERFLLSLSSCNRCLVVDDQLTVLPITSQHVLNITPVSKTSDLSQQEQELNALKTSLKDTQPVSALIDCCKTLDQGK  188 (333)
Q Consensus       109 ~rF~~Rf~~~L~~~~~~~i~d~~~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~T~dQ~~  188 (333)
                      |||++||+++|.+|+++++++++.. +|++.        .++.                 .++.+    +.+|+|.||++
T Consensus       133 ~~F~~rf~~~l~~~~~~~~~~~~~~-~~~~~--------~~~~-----------------~~~~~----~~~~~T~dQ~~  182 (671)
T 2zpa_A          133 PHFVQHLKRVLTADNEAILWRQNQP-FSLAH--------FTPR-----------------TDWYP----ATGAPQPEQQQ  182 (671)
T ss_dssp             HHHHHHHHHHHTSSSSSEEEETTSC-CCCCC--------CCCC-----------------CCCCC----CCSSCCHHHHH
T ss_pred             hhHHHHHHHHHHhCCCeEEEcCCCC-ccCCC--------CCCC-----------------ccccC----CCCCCCHHHHH
Confidence            9999999999999999999997632 23211        1111                 01222    24799999999


Q ss_pred             HHHHHHHHHhhhcccceeeEEecCCCChhhhhhhhhhhhhhcccchhhhhhhhhhhhccchhccccceeeeeccCCCchh
Q psy18105        189 ALLKFIDSISEKTLRSTVSLTAARGRGKSAALGLAVAGAVAFGYSNIFGKALLKFIDGISEKTLRSTVSLTAARGRGKSA  268 (333)
Q Consensus       189 al~~l~~~~~~~~~r~~lvlTAdRGRGKSAaLGla~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~vltA~RGRGKSa  268 (333)
                      ++++|++..              .|                                         .+||||+|||||||
T Consensus       183 al~~~~~~~--------------~~-----------------------------------------~~vlta~RGRGKSa  207 (671)
T 2zpa_A          183 LLKQLMTMP--------------PG-----------------------------------------VAAVTAARGRGKSA  207 (671)
T ss_dssp             HHHHHTTCC--------------SE-----------------------------------------EEEEEECTTSSHHH
T ss_pred             HHHHHHHhh--------------hC-----------------------------------------eEEEecCCCCCHHH
Confidence            998887431              12                                         36899999999999


Q ss_pred             HHHHHHHHHHHcCCceEEEeCCChhhHHHHHHHHHhcchh------cccccccceEEEe
Q psy18105        269 ALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDA------LAYQEHLDYSIVQ  321 (333)
Q Consensus       269 llGla~a~~~~~g~~~I~VTAPs~~~v~tlf~fa~~~L~~------lg~~~~~d~~~i~  321 (333)
                      ++|++++++..    +++||||+++|+++||+|+.+.++-      +...++.|+.||.
T Consensus       208 ~lG~~~a~~~~----~~~vtAP~~~a~~~l~~~~~~~i~~~~Pd~~~~~~~~~dlliVD  262 (671)
T 2zpa_A          208 LAGQLISRIAG----RAIVTAPAKASTDVLAQFAGEKFRFIAPDALLASDEQADWLVVD  262 (671)
T ss_dssp             HHHHHHHHSSS----CEEEECSSCCSCHHHHHHHGGGCCBCCHHHHHHSCCCCSEEEEE
T ss_pred             HHHHHHHHHHh----CcEEECCCHHHHHHHHHHhhCCeEEeCchhhhhCcccCCEEEEE
Confidence            99999999973    5899999999999999999886542      1344567998885
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.5
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.23
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.0
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.95
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.81
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.71
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.11
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.45
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.42
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 93.42
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 93.33
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.82
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 91.46
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 90.9
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 90.39
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 90.36
d1ls1a2 207 GTPase domain of the signal sequence recognition p 89.94
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 89.83
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 89.65
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.41
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 89.1
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 88.59
d1okkd2 207 GTPase domain of the signal recognition particle r 88.57
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 88.35
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 88.15
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 87.79
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 87.54
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 87.52
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 87.38
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 87.31
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 87.3
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 87.22
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 87.15
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 86.75
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 86.65
d1j8yf2 211 GTPase domain of the signal sequence recognition p 86.45
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 86.39
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.48
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 85.21
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 85.08
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.84
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 84.81
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 84.62
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 84.09
d1vmaa2 213 GTPase domain of the signal recognition particle r 83.99
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 83.75
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 83.69
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 83.31
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 83.09
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 82.69
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 82.37
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 82.35
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 82.24
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 81.12
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 80.74
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 80.44
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 80.37
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 80.36
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Helicase-like "domain" of reverse gyrase
domain: Helicase-like "domain" of reverse gyrase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=96.50  E-value=0.0053  Score=52.62  Aligned_cols=56  Identities=18%  Similarity=0.013  Sum_probs=42.2

Q ss_pred             eeeeeccCCCchhHHHHHHHHHHHcCCceEEEeCCChhhHHHHHHHHHhcchhcccc
Q psy18105        256 VSLTAARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPENLNTFFQFIFKGFDALAYQ  312 (333)
Q Consensus       256 ~vltA~RGRGKSallGla~a~~~~~g~~~I~VTAPs~~~v~tlf~fa~~~L~~lg~~  312 (333)
                      +++.|+-|-|||.+.-+++..+...| .+++|.+|+.+-+...++-+.+-.+.+|++
T Consensus        61 ~~i~apTGsGKT~~~~~~~~~~~~~~-~rvliv~Pt~~La~Q~~~~l~~~~~~~~~~  116 (237)
T d1gkub1          61 FAATAPTGVGKTSFGLAMSLFLALKG-KRCYVIFPTSLLVIQAAETIRKYAEKAGVG  116 (237)
T ss_dssp             EECCCCBTSCSHHHHHHHHHHHHTTS-CCEEEEESCHHHHHHHHHHHHHHHTTTCCS
T ss_pred             EEEEecCCChHHHHHHHHHHHHHHhc-CeEEEEeccHHHHHHHHHHHHHHHHHcCCc
Confidence            67789999999976555555555555 489999999999999988877655555543
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure